Property Summary

NCBI Gene PubMed Count 10
Grant Count 4
R01 Count 1
Funding $183,066.4
PubMed Score 7.03
PubTator Score 1.30

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (4)

Expression

  Differential Expression (3)

Disease log2 FC p
osteosarcoma 1.642 0.000
tuberculosis -1.100 0.000
ovarian cancer 1.400 0.008

Synonym

Accession Q52LA3
Symbols C14orf46
c14_5549

Gene

PDB

4YOO  

Gene RIF (1)

PMID Text
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)

AA Sequence

MGWKMASPTDGTDLEASLLSFEKLDRASPDLWPEQLPGVAEFAASFKSPITSSPPKWMAEIERDDIDMLK      1 - 70
ELGSLTTANLMEKVRGLQNLAYQLGLDESREMTRGKFLNILEKPKK                             71 - 116
//

Text Mined References (15)

PMID Year Title
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
21498570 2011 DYRK1A protein kinase promotes quiescence and senescence through DREAM complex assembly.
20585627 2010 Web-based, participant-driven studies yield novel genetic associations for common traits.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17671431 2007 LINC, a human complex that is related to pRB-containing complexes in invertebrates regulates the expression of G2/M genes.
17531812 2007 Evolutionarily conserved multisubunit RBL2/p130 and E2F4 protein complex represses human cell cycle-dependent genes in quiescence.
More...