Property Summary

NCBI Gene PubMed Count 20
PubMed Score 4.14
PubTator Score 75.28

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Disease Target Count Z-score Confidence
Chemical and Drug Induced Liver Injury 195 0.0 0.0
Cholestasis 155 0.0 0.0
Disease Target Count P-value
ovarian cancer 8520 9.4e-10
psoriasis 6694 2.0e-07
Pick disease 1894 8.1e-06
osteosarcoma 7950 2.2e-03
astrocytoma 1146 2.3e-03
progressive supranuclear palsy 676 7.9e-03
oligodendroglioma 2850 9.3e-03
group 3 medulloblastoma 4104 2.5e-02
ependymoma 4679 3.2e-02
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.8
Disease Target Count Z-score Confidence
Werner syndrome 29 3.5 1.8
Lyme disease 26 3.326 1.7

Expression

  Differential Expression (9)

Disease log2 FC p
astrocytoma 1.100 2.3e-03
ependymoma 1.200 3.2e-02
group 3 medulloblastoma 1.400 2.5e-02
oligodendroglioma 1.400 9.3e-03
osteosarcoma -1.196 2.2e-03
ovarian cancer -1.900 9.4e-10
Pick disease -1.700 8.1e-06
progressive supranuclear palsy -1.600 7.9e-03
psoriasis -1.200 2.0e-07

Gene RIF (4)

AA Sequence

MNFEGLDPGLAEYAPAMHSALDPVLDAHLNPSLLQNVELDPEGVALEALPVQESVHIMEGVYSELHSVVA      1 - 70
EVGVPVSVSHFDLHEEMLWVGSHGGHATSFFGPALERYSSFQVNGSDDIRQIQSLENGILFLTKNNLKYM     71 - 140
ARGGLIIFDYLLDENEDMHSLLLTDSSTLLVGGLQNHIIEIDLNTVQETQKYAVETPGVTIMRQTNRFFF    141 - 210
CGHTSGKVSLRDLRTFKVEHEFDAFSGSLSDFDVHGNLLAACGFSSRLTGLACDRFLKVYDLRMMRAITP    211 - 280
LQVHVDPAFLRFIPTYTSRLAIISQSGQCQFCEPTGLANPADIFHVNPVGPLLMTFDVSASKQALAFGDS    281 - 350
EGCVHLWTDSPEPSFNPYSRETEFALPCLVDSLPPLDWSQDLLPLSLIPVPLTTDTLLSDWPAANSAPAP    351 - 420
RRAPPVDAEILRTMKKVGFIGYAPNPRTRLRNQIPYRLKESDSEFDSFSQVTESPVGREEEPHLHMVSKK    421 - 490
YRKVTIKYSKLGLEDFDFKHYNKTLFAGLEPHIPNAYCNCMIQVLYFLEPVRCLIQNHLCQKEFCLACEL    491 - 560
GFLFHMLDLSRGDPCQGNNFLRAFRTIPEASALGLILADSDEASGKGNLARLIQRWNRFILTQLHQDMQE    561 - 630
LEIPQAYRGAGGSSFCSSGDSVIGQLFSCEMENCSLCRCGSETVRASSTLLFTLSYPDGSKSDKTGKNYD    631 - 700
FAQVLKRSICLDQNTQAWCDTCEKYQPTIQTRNIRHLPDILVINCEVNSSKEADFWRMQAEVAFKMAVKK    701 - 770
HGGEISKNKEFALADWKELGSPEGVLVCPSIEELKNVWLPFSIRMKMTKNKGLDVCNWTDGDEMQWGPAR    771 - 840
AEEEHGVYVYDLMATVVHILDSRTGGSLVAHIKVGETYHQRKEGVTHQQWYLFNDFLIEPIDKHEAVQFD    841 - 910
MNWKVPAILYYVKRNLNSRYNLNIKNPIEASVLLAEASLARKQRKTHTTFIPLMLNEMPQIGDLVGLDAE    911 - 980
FVTLNEEEAELRSDGTKSTIKPSQMSVARITCVRGQGPNEGIPFIDDYISTQEQVVDYLTQYSGIKPGDL    981 - 1050
DAKISSKHLTTLKSTYLKLRFLIDIGVKFVGHGLQKDFRVINLMVPKDQVLDTVYLFHMPRKRMISLRFL   1051 - 1120
AWYFLDLKIQGETHDSIEDARTALQLYRKYLELSKNGTEPESFHKVLKGLYEKGRKMDWKVPEPEGQTSP   1121 - 1190
KNAAVFSSVLAL                                                             1191 - 1202
//

Text Mined References (27)

PMID Year Title