Property Summary

NCBI Gene PubMed Count 9
PubMed Score 13.61
PubTator Score 3.33

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (3)

Disease log2 FC p
posterior fossa group B ependymoma 2.100 0.000
diabetes mellitus -1.100 0.002
nasopharyngeal carcinoma -1.600 0.000

Gene RIF (1)

PMID Text
19913896 MOPT is associated with dynamic regulation of acrosome biogenesis during late spermiogenesis.

AA Sequence

MNGFGRLEHFSGAVYEGQFKDNMFHGLGTYTFPNGAKYTGNFNENRVEGEGEYTDIQGLEWSGNFHFTAA      1 - 70
PDLKLKLHM                                                                  71 - 79
//

Text Mined References (9)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
23251661 2012 Novel genetic loci identified for the pathophysiology of childhood obesity in the Hispanic population.
19913896 2010 Identification and characterization of a novel mouse and human MOPT gene containing MORN-motif protein in testis.
19451621 2009 Reduced expression of the Kinesin-Associated Protein 3 (KIFAP3) gene increases survival in sporadic amyotrophic lateral sclerosis.
17924679 2007 Improved titanium dioxide enrichment of phosphopeptides from HeLa cells and high confident phosphopeptide identification by cross-validation of MS/MS and MS/MS/MS spectra.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11181995 2001 The sequence of the human genome.