Property Summary

NCBI Gene PubMed Count 9
PubMed Score 13.89
PubTator Score 3.33

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
ependymoma 4679 6.7e-10
nasopharyngeal carcinoma 1058 4.7e-04
diabetes mellitus 1728 1.9e-03
Disease Target Count Z-score Confidence
Amyotrophic lateral sclerosis 451 0.0 0.8

Expression

  Differential Expression (3)

Disease log2 FC p
diabetes mellitus -1.100 1.9e-03
ependymoma 1.500 6.7e-10
nasopharyngeal carcinoma -1.600 4.7e-04

Gene RIF (1)

AA Sequence

MNGFGRLEHFSGAVYEGQFKDNMFHGLGTYTFPNGAKYTGNFNENRVEGEGEYTDIQGLEWSGNFHFTAA      1 - 70
PDLKLKLHM                                                                  71 - 79
//

Text Mined References (9)

PMID Year Title