Property Summary

NCBI Gene PubMed Count 1
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (1)

Disease Z-score Confidence
Celiac disease 112 1.0

AA Sequence

MNAAVPPEQAHSCGWGTEGCPCLRSTAIRQTFFPGGDQFQRDGGLAMLPILVSKFLASSDPPVSVPEMLG      1 - 70
LQNRWRGMKNEEHCPGSFFLCKIRECVLNYRFQLQHPGFQHYLQSSGRRDRGRSEDKKPLEAGVWCWDRG     71 - 140
GWDGSSRAVHLLFRGVAHPSLYLFPREDPPRLLFPRLSLLVCEQFWCYSATLLLAPLPASTC            141 - 202
//

Text Mined References (1)

PMID Year Title
14574404 2003 The DNA sequence and analysis of human chromosome 6.