Property Summary

NCBI Gene PubMed Count 1
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count Z-score Confidence
Celiac disease 116 0.0 1.2

AA Sequence

MNAAVPPEQAHSCGWGTEGCPCLRSTAIRQTFFPGGDQFQRDGGLAMLPILVSKFLASSDPPVSVPEMLG      1 - 70
LQNRWRGMKNEEHCPGSFFLCKIRECVLNYRFQLQHPGFQHYLQSSGRRDRGRSEDKKPLEAGVWCWDRG     71 - 140
GWDGSSRAVHLLFRGVAHPSLYLFPREDPPRLLFPRLSLLVCEQFWCYSATLLLAPLPASTC            141 - 202
//

Text Mined References (1)

PMID Year Title