Property Summary

NCBI Gene PubMed Count 51
Grant Count 15
R01 Count 9
Funding $912,717.9
PubMed Score 52.67
PubTator Score 25.44

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (1)

Disease Z-score Confidence
malignant mesothelioma 3,162

Expression

  Differential Expression (1)

Disease log2 FC p
malignant mesothelioma 1.500 0.000

Gene RIF (36)

PMID Text
26239614 Study shows miR-205 significantly downregulated and directly target the 3'-UTR of AMOT in breast cancer. In vitro, miR-205 regulates the proliferation and invasion of breast cancer cells through suppression of AMOT expression.
26045165 angiomotin and Merlin respectively interface cortical actin filaments and core kinases in Hippo signaling
25647626 Amot was highly expressed in breast cancer tissues and was important in the promotion of breast cancer cell proliferation and invasion. Amot knockdown in MCF-7 cells decreased the expression of YAP, YAP/TAZ and LATS1.
25633977 experiments indicate that AMOT and other motin family members function together with NEDD4L to help complete immature virion assembly prior to ESCRT-mediated virus budding
25633977 Angiomotin (AMOT) depletion inhibits HIV-1 Gag release from cells, but expression of AMOT-like protein 1 and AMOT-like protein 2 can rescue HIV-1 Gag release
25633977 Angiomotin (AMOT) depletion inhibits HIV-1 Gag release from cells, but expression of AMOT-like protein 1 and AMOT-like protein 2 can rescue HIV-1 Gag release
25633977 Angiomotin (AMOT) depletion inhibits HIV-1 Gag release from cells, but expression of AMOT-like protein 1 and AMOT-like protein 2 can rescue HIV-1 Gag release
25633977 Knockdown of angiomotin (AMOT) by shRNA library screening inhibits HIV-1 replication in cultured Jurkat T-cells
25633977 Knockdown of angiomotin (AMOT) by shRNA library screening inhibits HIV-1 replication in cultured Jurkat T-cells
25381822 AMOT is a crucial suppressor of lung cancer metastasis and highlight its critical role as a tumor suppressor and its potential as a prognostic biomarker and therapeutic target for lung cancer.
More...

AA Sequence

MRNSEEQPSGGTTVLQRLLQEQLRYGNPSENRSLLAIHQQATGNGPPFPSGSGNPGPQSDVLSPQDHHQQ      1 - 70
LVAHAARQEPQGQEIQSENLIMEKQLSPRMQNNEELPTYEEAKVQSQYFRGQQHASVGAAFYVTGVTNQK     71 - 140
MRTEGRPSVQRLNPGKMHQDEGLRDLKQGHVRSLSERLMQMSLATSGVKAHPPVTSAPLSPPQPNDLYKN    141 - 210
PTSSSEFYKAQGPLPNQHSLKGMEHRGPPPEYPFKGMPPQSVVCKPQEPGHFYSEHRLNQPGRTEGQLMR    211 - 280
YQHPPEYGAARPAQDISLPLSARNSQPHSPTSSLTSGGSLPLLQSPPSTRLSPARHPLVPNQGDHSAHLP    281 - 350
RPQQHFLPNQAHQGDHYRLSQPGLSQQQQQQQQQHHHHHHHQQQQQQQPQQQPGEAYSAMPRAQPSSASY    351 - 420
QPVPADPFAIVSRAQQMVEILSDENRNLRQELEGCYEKVARLQKVETEIQRVSEAYENLVKSSSKREALE    421 - 490
KAMRNKLEGEIRRMHDFNRDLRERLETANKQLAEKEYEGSEDTRKTISQLFAKNKESQREKEKLEAELAT    491 - 560
ARSTNEDQRRHIEIRDQALSNAQAKVVKLEEELKKKQVYVDKVEKMQQALVQLQAACEKREQLEHRLRTR    561 - 630
LERELESLRIQQRQGNCQPTNVSEYNAAALMELLREKEERILALEADMTKWEQKYLEENVMRHFALDAAA    631 - 700
TVAAQRDTTVISHSPNTSYDTALEARIQKEEEEILMANKRCLDMEGRIKTLHAQIIEKDAMIKVLQQRSR    701 - 770
KEPSKTEQLSCMRPAKSLMSISNAGSGLLSHSSTLTGSPIMEEKRDDKSWKGSLGILLGGDYRAEYVPST    771 - 840
PSPVPPSTPLLSAHSKTGSRDCSTQTERGTESNKTAAVAPISVPAPVAAAATAAAITATAATITTTMVAA    841 - 910
APVAVAAAAAPAAAAAPSPATAAATAAAVSPAAAGQIPAAASVASAAAVAPSAAAAAAVQVAPAAPAPVP    911 - 980
APALVPVPAPAAAQASAPAQTQAPTSAPAVAPTPAPTPTPAVAQAEVPASPATGPGPHRLSIPSLTCNPD    981 - 1050
KTDGPVFHSNTLERKTPIQILGQEPDAEMVEYLI                                       1051 - 1084
//

Text Mined References (54)

PMID Year Title
26239614 2015 MicroRNA-205 inhibits the proliferation and invasion of breast cancer by regulating AMOT expression.
26045165 2015 Angiomotin binding-induced activation of Merlin/NF2 in the Hippo pathway.
25647626 2015 Angiomotin promotes breast cancer cell proliferation and invasion.
25633977 2015 Angiomotin functions in HIV-1 assembly and budding.
25556234 2015 New host factors important for respiratory syncytial virus (RSV) replication revealed by a novel microfluidics screen for interactors of matrix (M) protein.
25416956 2014 A proteome-scale map of the human interactome network.
25381822 2015 Angiomotin decreases lung cancer progression by sequestering oncogenic YAP/TAZ and decreasing Cyr61 expression.
25218447 2014 Uncovering global SUMOylation signaling networks in a site-specific manner.
25026211 2014 Merlin/NF2 loss-driven tumorigenesis linked to CRL4(DCAF1)-mediated inhibition of the hippo pathway kinases Lats1 and 2 in the nucleus.
24648494 2014 Angiomotins link F-actin architecture to Hippo pathway signaling.
More...