Property Summary

NCBI Gene PubMed Count 1
PubMed Score 0.00

Knowledge Summary

Patent

No data available

AA Sequence

MATLGFVTPEAPFESSKPPIFEGLSPTVYSNPEGFKEKFLRKTRENPVVPIGFLCTAAVLTNGLYCFHQG      1 - 70
NSQCSRLMMHTQIAAQGFTIAAILLGLAATAMKSPP                                       71 - 106
//

Text Mined References (2)

PMID Year Title