Property Summary

NCBI Gene PubMed Count 10
PubMed Score 1.59
PubTator Score 0.31

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
acute myeloid leukemia 760 4.1e-02
Breast cancer 3469 4.7e-02

Expression

  Differential Expression (2)

Disease log2 FC p
acute myeloid leukemia -1.100 4.1e-02
Breast cancer 2.100 4.7e-02

Gene RIF (1)

AA Sequence

MAGNLLSGAGRRLWDWVPLACRSFSLGVPRLIGIRLTLPPPKVVDRWNEKRAMFGVYDNIGILGNFEKHP      1 - 70
KELIRGPIWLRGWKGNELQRCIRKRKMVGSRMFADDLHNLNKRIRYLYKHFNRHGKFR                 71 - 128
//

Text Mined References (13)

PMID Year Title