Property Summary

NCBI Gene PubMed Count 3
PubMed Score 0.00

Knowledge Summary

Patent

No data available

Synonym

Accession Q4KN68 A2A2S9 Q5QPC4
Symbols C20orf62
dJ1013A22.3

 Compartment GO Term (0)

AA Sequence

MAYYFHFYGELPSQESPHPGVYSPHPQGGWQPTADSYREWHNEDLNPRMSHWTYAQELVSYKKTSFIVWR      1 - 70
HRISPNGVTSRKPYCHFHGGQWPGPTPPSCLSSAFASGSFSHFEDSPYILLHVVLQMCWLRAQRLNQRDL     71 - 140
GLNPTSAIEHQLSDLDCVPLLLWASDSPSE                                            141 - 170
//

Text Mined References (3)

PMID Year Title