Property Summary

NCBI Gene PubMed Count 3
PubMed Score 0.49
PubTator Score 1.42

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
osteosarcoma 7950 1.2e-06
hepatocellular carcinoma 547 2.0e-06
medulloblastoma, large-cell 6241 1.3e-04
gastric cancer 459 4.5e-04
Rheumatoid arthritis 1191 7.4e-04
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.7

Expression

  Differential Expression (5)

Disease log2 FC p
gastric cancer 1.200 4.5e-04
hepatocellular carcinoma 1.100 2.0e-06
medulloblastoma, large-cell -1.100 1.3e-04
osteosarcoma 3.108 1.2e-06
Rheumatoid arthritis 1.900 7.4e-04

Gene RIF (5)

AA Sequence

MRRYLRVVVLCVACGFCSLLYAFSQLAVSLEEGTGGGGGKPQAAVASWLAGGGRGAVRGAGVAGPAAHPG      1 - 70
VSDRCKDFSLCYWNPYWMLPSDVCGMNCFWEAAFRYSLKIQPVEKMHLAVVACGERLEETMTMLKSAIIF     71 - 140
SIKPLQFHIFAEDQLHHSFKGRLDNWSFLQTFNYTLYPITFPSENAAEWKKLFKPCASQRLFLPLILKEV    141 - 210
DSLLYVDTDILFLRPVDDIWSLLKKFNSTQIAAMAPEHEEPRIGWYNRFARHPYYGKTGVNSGVMLMNMT    211 - 280
RMRRKYFKNDMTTVRLQWGDILMPLLKKYKLNITWGDQDLLNIVFFHNPESLFVFPCQWNYRPDHCIYGS    281 - 350
NCQEAEEGGIFILHGNRGVYHDDKQPAFRAVYEALRNCSFEDDNIRSLLKPLELELQKTVHTYCGKIYKI    351 - 420
FIKQLAKSVRDRYARSPKEK                                                      421 - 440
//

Text Mined References (7)

PMID Year Title