Property Summary

NCBI Gene PubMed Count 10
PubMed Score 0.00
PubTator Score 1.50

Knowledge Summary


No data available


  Disease Sources (1)

Disease Target Count P-value
Breast cancer 3099 8.74756235486578E-32
breast carcinoma 1614 4.20010584788944E-22
non-small cell lung cancer 2798 2.12457458088244E-15
lung carcinoma 2844 8.62938546963707E-11
lung adenocarcinoma 2714 7.24825607525666E-10
atypical teratoid/rhabdoid tumor 1095 1.55770727585797E-6
group 4 medulloblastoma 1875 1.23003418195379E-5
invasive ductal carcinoma 2950 2.197144178554E-4
ovarian cancer 8492 3.71577563270417E-4
medulloblastoma, large-cell 6234 4.42307457855394E-4
intraductal papillary-mucinous carcinoma (IPMC) 2988 0.00107137803522763
intraductal papillary-mucinous adenoma (IPMA) 2956 0.00112289148355536
ductal carcinoma in situ 1745 0.00125139930395703
adrenocortical carcinoma 1427 0.00141795566474853
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.00212589207083651
mucosa-associated lymphoid tissue lymphoma 480 0.0206234195945036
non diabetic and post-ischemic heart failure 200 0.0258796457610624

Gene RIF (3)

24033743 GGTA1/CMAH knockout pig samples had increased relative amounts of high-mannose, incomplete, and xylosylated N-linked glycans
12499400 A transcription of the complete gene sequence for this enzyme
11773054 Molecular basis of evolutionary loss of the alpha 1,3-galactosyltransferase gene

AA Sequence

DIDKEKGREETKGRKMTQQSFGYGTGLIQT                                             71 - 100

Text Mined References (12)

PMID Year Title
25315716 2015 Significance of the evolutionary ?1,3-galactosyltransferase (GGTA1) gene inactivation in preventing extinction of apes and old world monkeys.
24033743 N-linked glycan profiling of GGTA1/CMAH knockout pigs identifies new potential carbohydrate xenoantigens.
18357469 2008 The human gamma-glutamyltransferase gene family.
17213182 2006 Identification of genes related to Parkinson's disease using expressed sequence tags.
17194757 2007 Functionally important glycosyltransferase gain and loss during catarrhine primate emergence.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15164053 2004 DNA sequence and analysis of human chromosome 9.
12499400 2002 A complete alpha1,3-galactosyltransferase gene is present in the human genome and partially transcribed.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11773054 2002 Molecular basis of evolutionary loss of the alpha 1,3-galactosyltransferase gene in higher primates.