Property Summary

NCBI Gene PubMed Count 10
PubMed Score 0.00
PubTator Score 1.50

Knowledge Summary

Patent

No data available

Gene RIF (3)

AA Sequence

MNVKGKVILSMLVVSTVIIVFWEFINSTEGSFLWIYHSKNPEVDDSSAQKGWWFLSWFNNGIHNYQQGEE      1 - 70
DIDKEKGREETKGRKMTQQSFGYGTGLIQT                                             71 - 100
//

Text Mined References (12)

PMID Year Title