Property Summary

NCBI Gene PubMed Count 10
PubMed Score 0.00
PubTator Score 1.50

Knowledge Summary

Patent

No data available

Gene RIF (3)

PMID Text
24033743 GGTA1/CMAH knockout pig samples had increased relative amounts of high-mannose, incomplete, and xylosylated N-linked glycans
12499400 A transcription of the complete gene sequence for this enzyme
11773054 Molecular basis of evolutionary loss of the alpha 1,3-galactosyltransferase gene

AA Sequence

MNVKGKVILSMLVVSTVIIVFWEFINSTEGSFLWIYHSKNPEVDDSSAQKGWWFLSWFNNGIHNYQQGEE      1 - 70
DIDKEKGREETKGRKMTQQSFGYGTGLIQT                                             71 - 100
//

Text Mined References (12)

PMID Year Title
25315716 2015 Significance of the evolutionary ?1,3-galactosyltransferase (GGTA1) gene inactivation in preventing extinction of apes and old world monkeys.
24033743 N-linked glycan profiling of GGTA1/CMAH knockout pigs identifies new potential carbohydrate xenoantigens.
18357469 2008 The human gamma-glutamyltransferase gene family.
17213182 2006 Identification of genes related to Parkinson's disease using expressed sequence tags.
17194757 2007 Functionally important glycosyltransferase gain and loss during catarrhine primate emergence.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15164053 2004 DNA sequence and analysis of human chromosome 9.
12499400 2002 A complete alpha1,3-galactosyltransferase gene is present in the human genome and partially transcribed.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11773054 2002 Molecular basis of evolutionary loss of the alpha 1,3-galactosyltransferase gene in higher primates.
More...