Property Summary

NCBI Gene PubMed Count 11
PubMed Score 5.85
PubTator Score 141.89

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (19)

Disease log2 FC p
active Crohn's disease 1.905 2.4e-02
adult high grade glioma -1.600 1.7e-03
atypical teratoid / rhabdoid tumor -1.600 1.9e-03
Breast cancer 2.800 2.5e-02
chronic rhinosinusitis -1.295 4.1e-02
cystic fibrosis 1.451 1.4e-04
glioblastoma -1.800 5.3e-03
group 3 medulloblastoma -1.500 5.0e-03
invasive ductal carcinoma 1.100 4.5e-02
lung cancer 1.400 1.1e-04
lung carcinoma 1.200 2.4e-11
malignant mesothelioma -2.100 4.1e-07
medulloblastoma, large-cell -2.900 8.1e-06
osteosarcoma 1.108 1.1e-03
ovarian cancer 1.500 4.5e-06
posterior fossa group B ependymoma 1.100 1.3e-04
psoriasis -1.900 8.7e-05
tuberculosis -1.100 2.3e-04
ulcerative colitis 1.300 8.8e-05

Gene RIF (6)

AA Sequence

MSDEVFSTTLAYTKSPKVTKRTTFQDELIRAITARSARQRSSEYSDDFDSDEIVSLGDFSDTSADENSVN      1 - 70
KKMNDFHISDDEEKNPSKLLFLKTNKSNGNITKDEPVCAIKNEEEMAPDGCEDIVVKSFSESQNKDEEFE     71 - 140
KDKIKMKPKPRILSIKSTSSAENNSLDTDDHFKPSPRPRSMLKKKSHMEEKDGLEDKETALSEELELHSA    141 - 210
PSSLPTPNGIQLEAEKKAFSENLDPEDSCLTSLASSSLKQILGDSFSPGSEGNASGKDPNEEITENHNSL    211 - 280
KSDENKENSFSADHVTTAVEKSKESQVTADDLEEEKAKAELIMDDDRTVDPLLSKSQSILISTSATASSK    281 - 350
KTIEDRNIKNKKSTNNRASSASARLMTSEFLKKSSSKRRTPSTTTSSHYLGTLKVLDQKPSQKQSIEPDR    351 - 420
ADNIRAAVYQEWLEKKNVYLHEMHRIKRIESENLRIQNEQKKAAKREEALASFEAWKAMKEKEAKKIAAK    421 - 490
KRLEEKNKKKTEEENAARKGEALQAFEKWKEKKMEYLKEKNRKEREYERAKKQKEEETVAEKKKDNLTAV    491 - 560
EKWNEKKEAFFKQKEKEKINEKRKEELKRAEKKDKDKQAINEYEKWLENKEKQERIERKQKKRHSFLESE    561 - 630
ALPPWSPPSRTVFAKVF                                                         631 - 647
//

Text Mined References (14)

PMID Year Title