Property Summary

NCBI Gene PubMed Count 11
PubMed Score 5.31
PubTator Score 141.89

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (3)

Disease Target Count P-value
lung carcinoma 2844 2.37242384520367E-11
malignant mesothelioma 3163 4.05401078995464E-7
ovarian cancer 8492 4.46621273483603E-6
medulloblastoma, large-cell 6234 8.14203561523982E-6
medulloblastoma 1524 7.6105444273237E-5
psoriasis 6685 8.70654330221663E-5
ulcerative colitis 2087 8.81902907408772E-5
lung cancer 4473 1.07065506201042E-4
posterior fossa group B ependymoma 1530 1.34358837023703E-4
tuberculosis 1563 2.2968377630411E-4
osteosarcoma 7933 0.00113845099425736
adult high grade glioma 2148 0.0016585294474317
atypical teratoid / rhabdoid tumor 4369 0.00194728554990972
cystic fibrosis and chronic rhinosinusitis 213 0.00422680499889292
glioblastoma 5572 0.00528586238830393
active Crohn's disease 918 0.023788981746322
Breast cancer 3099 0.0248609387717636
chronic rhinosinusitis 512 0.0328317682776207
invasive ductal carcinoma 2950 0.0447319143088207
Disease Target Count Z-score Confidence
Cardiovascular system disease 194 0.0 2.0
Disease Target Count Z-score Confidence
cone-rod dystrophy 60 4.255 2.1

Expression

  Differential Expression (19)

Disease log2 FC p
malignant mesothelioma -2.100 0.000
psoriasis -1.900 0.000
osteosarcoma 1.108 0.001
medulloblastoma -2.200 0.000
cystic fibrosis and chronic rhinosinusit... -1.939 0.004
atypical teratoid / rhabdoid tumor -1.600 0.002
glioblastoma -1.800 0.005
medulloblastoma, large-cell -2.900 0.000
tuberculosis -1.100 0.000
lung cancer 1.400 0.000
active Crohn's disease 1.905 0.024
Breast cancer 2.800 0.025
adult high grade glioma -1.600 0.002
posterior fossa group B ependymoma 1.100 0.000
lung carcinoma 1.200 0.000
invasive ductal carcinoma 1.100 0.045
ulcerative colitis 1.300 0.000
ovarian cancer 1.500 0.000
chronic rhinosinusitis -1.460 0.033

Synonym

Accession Q49MG5 Q4W5I7 Q68DU1 Q9H781 Q9H7B6
Symbols ASAP

Gene

  Ortholog (9)

Gene RIF (6)

PMID Text
24876664 MAP9 downregulation is associated with colorectal malignancy.
22672907 ASAP stabilizes p53 both by alleviating MDM2-mediated p53 ubiquitination and by enhancing its p300-dependent acetylation.
20615875 Results highlight dual ASAP regulation by Plk1 and further confirm the importance of ASAP for spindle pole organization, bipolar spindle assembly, and mitosis.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
17925329 Study demonstrates that AurA-mediated phosphorylation of ASAP is essential to spindle formation and mitosis.
16049101 ASAP is a human microtubule-associated protein required for bipolar spindle assembly and cytokinesis.

AA Sequence

MSDEVFSTTLAYTKSPKVTKRTTFQDELIRAITARSARQRSSEYSDDFDSDEIVSLGDFSDTSADENSVN      1 - 70
KKMNDFHISDDEEKNPSKLLFLKTNKSNGNITKDEPVCAIKNEEEMAPDGCEDIVVKSFSESQNKDEEFE     71 - 140
KDKIKMKPKPRILSIKSTSSAENNSLDTDDHFKPSPRPRSMLKKKSHMEEKDGLEDKETALSEELELHSA    141 - 210
PSSLPTPNGIQLEAEKKAFSENLDPEDSCLTSLASSSLKQILGDSFSPGSEGNASGKDPNEEITENHNSL    211 - 280
KSDENKENSFSADHVTTAVEKSKESQVTADDLEEEKAKAELIMDDDRTVDPLLSKSQSILISTSATASSK    281 - 350
KTIEDRNIKNKKSTNNRASSASARLMTSEFLKKSSSKRRTPSTTTSSHYLGTLKVLDQKPSQKQSIEPDR    351 - 420
ADNIRAAVYQEWLEKKNVYLHEMHRIKRIESENLRIQNEQKKAAKREEALASFEAWKAMKEKEAKKIAAK    421 - 490
KRLEEKNKKKTEEENAARKGEALQAFEKWKEKKMEYLKEKNRKEREYERAKKQKEEETVAEKKKDNLTAV    491 - 560
EKWNEKKEAFFKQKEKEKINEKRKEELKRAEKKDKDKQAINEYEKWLENKEKQERIERKQKKRHSFLESE    561 - 630
ALPPWSPPSRTVFAKVF                                                         631 - 647
//

Text Mined References (14)

PMID Year Title
24876664 2014 Expression of the microtubule-associated protein MAP9/ASAP and its partners AURKA and PLK1 in colorectal and breast cancers.
22672907 2012 Induction of ASAP (MAP9) contributes to p53 stabilization in response to DNA damage.
20615875 2010 Plk1 regulates both ASAP localization and its role in spindle pole integrity.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
17925329 2008 ASAP is a novel substrate of the oncogenic mitotic kinase Aurora-A: phosphorylation on Ser625 is essential to spindle formation and mitosis.
16049101 2005 ASAP, a human microtubule-associated protein required for bipolar spindle assembly and cytokinesis.
More...