Property Summary

NCBI Gene PubMed Count 7
PubMed Score 0.15
PubTator Score 0.50

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
non-small cell lung cancer 2798 9.77049907611625E-10
osteosarcoma 7933 2.48148842823872E-6
malignant mesothelioma 3163 6.35228264449482E-6
medulloblastoma, large-cell 6234 7.07680639386548E-6
Pick disease 1893 4.42610338104633E-4
atypical teratoid / rhabdoid tumor 4369 0.00118935733265021
group 4 medulloblastoma 1875 0.00165417329632726
astrocytic glioma 2241 0.0186296798980143
adrenocortical carcinoma 1427 0.0234809362882791

Expression

  Differential Expression (9)

Disease log2 FC p
malignant mesothelioma 1.200 0.000
astrocytic glioma -1.600 0.019
osteosarcoma 3.093 0.000
atypical teratoid / rhabdoid tumor 1.100 0.001
group 4 medulloblastoma 1.500 0.002
medulloblastoma, large-cell 1.800 0.000
adrenocortical carcinoma 1.103 0.023
non-small cell lung cancer 1.119 0.000
Pick disease -1.100 0.000

Synonym

Accession Q49AR2 Q8ND28 Q8WU61 Q9NUR1
Symbols

Gene

  Ortholog (10)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Opossum OMA EggNOG
Platypus OMA EggNOG
Chicken OMA EggNOG Inparanoid
Anole lizard OMA EggNOG
Xenopus OMA EggNOG

 Compartment GO Term (1)

AA Sequence

MSDSAGGRAGLRRYPKLPVWVVEDHQEVLPFIYRAIGSKHLPASNVSFLHFDSHPDLLIPVNMPADTVFD      1 - 70
KETLFGELSIENWIMPAVYAGHFSHVIWFHPTWAQQIREGRHHFLVGKDTSTTTIRVTSTDHYFLSDGLY     71 - 140
VPEDQLENQKPLQLDVIMVKPYKLCNNQEENDAVSSAKKPKLALEDSENTASTNCDSSSEGLEKDTATQR    141 - 210
SDQTCLEPSCSCSSENQECQTAASTGEILEILKKGKAFVLDIDLDFFSVKNPFKEMFTQEEYKILQELYQ    211 - 280
FKKPGTNLTEEDLVDIVDTRIHQLEDLEATFADLCDGDDEETVQRWASNPGMESLVPLVQSLKKRMEVPD    281 - 350
YEMVHQAGLTCDYSELPHHISTEQEIECLIQSVHYLLKNLPNPTLVTIARSSLDDYCPSDQVDTIQEKVL    351 - 420
NMLRALYGNLDLQVYAAESPPS                                                    421 - 442
//

Text Mined References (11)

PMID Year Title
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
9110174 1997 Large-scale concatenation cDNA sequencing.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.
More...