Property Summary

NCBI Gene PubMed Count 7
PubMed Score 0.15
PubTator Score 0.50

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
adrenocortical carcinoma 1.103 2.3e-02
astrocytic glioma -1.600 1.9e-02
atypical teratoid / rhabdoid tumor 1.100 1.2e-03
group 4 medulloblastoma 1.500 1.7e-03
malignant mesothelioma 1.200 6.4e-06
medulloblastoma, large-cell 1.800 7.1e-06
non-small cell lung cancer 1.119 9.8e-10
osteosarcoma 3.093 2.5e-06
Pick disease -1.100 4.4e-04

AA Sequence

MSDSAGGRAGLRRYPKLPVWVVEDHQEVLPFIYRAIGSKHLPASNVSFLHFDSHPDLLIPVNMPADTVFD      1 - 70
KETLFGELSIENWIMPAVYAGHFSHVIWFHPTWAQQIREGRHHFLVGKDTSTTTIRVTSTDHYFLSDGLY     71 - 140
VPEDQLENQKPLQLDVIMVKPYKLCNNQEENDAVSSAKKPKLALEDSENTASTNCDSSSEGLEKDTATQR    141 - 210
SDQTCLEPSCSCSSENQECQTAASTGEILEILKKGKAFVLDIDLDFFSVKNPFKEMFTQEEYKILQELYQ    211 - 280
FKKPGTNLTEEDLVDIVDTRIHQLEDLEATFADLCDGDDEETVQRWASNPGMESLVPLVQSLKKRMEVPD    281 - 350
YEMVHQAGLTCDYSELPHHISTEQEIECLIQSVHYLLKNLPNPTLVTIARSSLDDYCPSDQVDTIQEKVL    351 - 420
NMLRALYGNLDLQVYAAESPPS                                                    421 - 442
//

Text Mined References (11)

PMID Year Title