Property Summary

NCBI Gene PubMed Count 10
PubMed Score 7.41
PubTator Score 5.49

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (1)

Disease log2 FC p
psoriasis 1.900 0.000

Synonym

Accession Q496F6 B4DNS1 Q7Z7I3 CLM-2
Symbols CLM2
CLM-2
IREM2
PIgR2
IREM-2
PIgR-2
CD300LE
CMRF35-A5

Gene

Gene RIF (3)

PMID Text
23072861 CD300 molecules are all expressed by DC; CD300b, d, e and f are restricted to different subpopulations of the myeloid DC lineage. They have been shown to regulate DC function both in vitro and in vivo.
20200953 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
15557162 IREM-2 is a novel activating immunoglobulin-like receptor expressed on mature hemopoietic cells of the monocytic and myeloid dendritic cell lineages.

AA Sequence

MWLLPALLLLCLSGCLSLKGPGSVTGTAGDSLTVWCQYESMYKGYNKYWCRGQYDTSCESIVETKGEEKV      1 - 70
ERNGRVSIRDHPEALAFTVTMQNLNEDDAGSYWCKIQTVWVLDSWSRDPSDLVRVYVSPAITTPRRTTHP     71 - 140
ATPPIFLVVNPGRNLSTGEVLTQNSGFRLSSPHFLLVVLLKLPLLLSMLGAVFWVNRPQWAPPGR         141 - 205
//

Text Mined References (15)

PMID Year Title
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23072861 2013 CD300 molecule regulation of human dendritic cell functions.
20200953 2010 Genome-wide pleiotropy of osteoporosis-related phenotypes: the Framingham Study.
20039296 2010 Functional analysis of the CD300e receptor in human monocytes and myeloid dendritic cells.
19592130 2009 The CD300 molecules regulate monocyte and dendritic cell functions.
19359216 2009 The CD300 family of molecules are evolutionarily significant regulators of leukocyte functions.
16959974 2006 The consensus coding sequences of human breast and colorectal cancers.
16920917 2006 Molecular and functional characterization of CD300b, a new activating immunoglobulin receptor able to transduce signals through two different pathways.
16625196 2006 DNA sequence of human chromosome 17 and analysis of rearrangement in the human lineage.
15557162 2004 Molecular characterization of a novel immune receptor restricted to the monocytic lineage.
More...