Property Summary

NCBI Gene PubMed Count 2
PubMed Score 10.97
PubTator Score 1.49

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count Z-score Confidence
Azoospermia 110 3.28 1.6

Expression

Gene RIF (1)

AA Sequence

MSPSMLTGNSPRGCRLPSISSTTCGRQLEKVPEKRDSGMTEVERTYSANCSDFLESKGCFANTTPSGKSV      1 - 70
SSSSSVETGPSVSEPPGLPRVSAYVDTTADLDRKLSFSHSDHSSEMSLPEVQKDKYPEEFSLLKLQTKDG     71 - 140
HRPEWTFYPRFSSNIHTYHVGKQCFFNGVFLGNKRSLSERTVDKCFGRKKYDIDPRNGIPKLTPGDNPYM    141 - 210
YPEQSKGFHKAGSMLPPVNFSIVPYEKKFDTFIPLEPLPQIPNLPFWVKEKANSLKNEIQEVEELDNWQP    211 - 280
AVPLMHMLHLSGALDFPRQS                                                      281 - 300
//

Text Mined References (4)

PMID Year Title