Property Summary

NCBI Gene PubMed Count 2
Grant Count 6
Funding $535,715.5
PubMed Score 10.97
PubTator Score 1.49

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (1)

Disease Z-score Confidence
Azoospermia 89 3.275 1.6

Gene RIF (1)

PMID Text
20603214 Dishevelled-DEP domain interacting protein is a negative regulator of the canonical Wnt signaling.

AA Sequence

MSPSMLTGNSPRGCRLPSISSTTCGRQLEKVPEKRDSGMTEVERTYSANCSDFLESKGCFANTTPSGKSV      1 - 70
SSSSSVETGPSVSEPPGLPRVSAYVDTTADLDRKLSFSHSDHSSEMSLPEVQKDKYPEEFSLLKLQTKDG     71 - 140
HRPEWTFYPRFSSNIHTYHVGKQCFFNGVFLGNKRSLSERTVDKCFGRKKYDIDPRNGIPKLTPGDNPYM    141 - 210
YPEQSKGFHKAGSMLPPVNFSIVPYEKKFDTFIPLEPLPQIPNLPFWVKEKANSLKNEIQEVEELDNWQP    211 - 280
AVPLMHMLHLSGALDFPRQS                                                      281 - 300
//

Publication (4)

PMID Year Title
20603214 2010 Dishevelled-DEP domain interacting protein (DDIP) inhibits Wnt signaling by promoting TCF4 degradation and disrupting the TCF4/beta-catenin complex.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.