Property Summary

NCBI Gene PubMed Count 5
PubMed Score 2.39

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (1)

Disease Z-score Confidence
facioscapulohumeral dystrophy 286

Synonym

Accession Q495X7 Q8NA35
Symbols RNF33
RNF129

Gene

 GO Function (1)

 GO Component (1)

 Compartment GO Term (0)

Gene RIF (1)

PMID Text
19240061 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MEFVTALVNLQEESSCPICLEYLKDPVTINCGHNFCRSCLSVSWKDLDDTFPCPVCRFCFPYKSFRRNPQ      1 - 70
LRNLTEIAKQLQIRRSKRKRQKENAMCEKHNQFLTLFCVKDLEILCTQCSFSTKHQKHYICPIKKAASYH     71 - 140
REILEGSLEPLRNNIERVEKVIILQGSKSVELKKKVEYKREEINSEFEQIRLFLQNEQEMILRQIQDEEM    141 - 210
NILAKLNENLVELSDYVSTLKHLLREVEGKSVQSNLELLTQAKSMHHKYQNLKCPELFSFRLTKYGFSLP    211 - 280
PQYSGLDRIIKPFQVDVILDLNTAHPQLLVSEDRKAVRYERKKRNICYDPRRFYVCPAVLGSQRFSSGRH    281 - 350
YWEVEVGNKPKWILGVCQDCLLRNWQDQPSVLGGFWAIGRYMKSGYVASGPKTTQLLPVVKPSKIGIFLD    351 - 420
YELGDLSFYNMNDRSILYTFNDCFTEAVWPYFYTGTDSEPLKICSVSDSER                       421 - 471
//

Text Mined References (5)

PMID Year Title
19240061 2009 Coeliac disease-associated risk variants in TNFAIP3 and REL implicate altered NF-kappaB signalling.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
8744354 1996 Does this have a familiar RING?