Property Summary

NCBI Gene PubMed Count 7
PubMed Score 1.20
PubTator Score 1.70

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count P-value
ovarian cancer 8519 2.3e-06
osteosarcoma 7950 6.2e-04
primary pancreatic ductal adenocarcinoma 1108 7.3e-04
pancreatic cancer 2398 8.1e-04
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.6
Disease Target Count Z-score Confidence
substance-related disorder 162 0.0 0.8

Expression

  Differential Expression (4)

Disease log2 FC p
osteosarcoma 1.419 6.2e-04
ovarian cancer -1.100 2.3e-06
pancreatic cancer 1.500 8.1e-04
primary pancreatic ductal adenocarcinoma 1.532 7.3e-04

Gene RIF (2)

AA Sequence

MAAGPIRVVLVLLGVLSVCAASGHGSVAEREAGGEAEWAEPWDGAVFRPPSALGAVGVTRSSGTPRPGRE      1 - 70
EAGDLPVLLWWSPGLFPHFPGDSERIECARGACVASRNRRALRDSRTRALLFYGTDFRASAAPLPRLAHQ     71 - 140
SWALLHEESPLNNFLLSHGPGIRLFNLTSTFSRHSDYPLSLQWLPGTAYLRRPVPPPMERAEWRRRGYAP    141 - 210
LLYLQSHCDVPADRDRYVRELMRHIPVDSYGKCLQNRELPTARLQDTATATTEDPELLAFLSRYKFHLAL    211 - 280
ENAICNDYMTEKLWRPMHLGAVPVYRGSPSVRDWMPNNHSVILIDDFESPQKLAEFIDFLDKNDEEYMKY    281 - 350
LAYKQPGGITNQFLLDSLKHREWGVNDPLLPNYLNGFECFVCDYELARLDAEKAHAASPGDSPVFEPHIA    351 - 420
QPSHMDCPVPTPGFGNVEEIPENDSWKEMWLQDYWQGLDQGEALTAMIHNNETEQTKFWDYLHEIFMKRQ    421 - 490
HL                                                                        491 - 492
//

Text Mined References (9)

PMID Year Title