Property Summary

NCBI Gene PubMed Count 7
PubMed Score 1.13
PubTator Score 1.70

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (4)

Disease log2 FC p
osteosarcoma 1.419 0.001
primary pancreatic ductal adenocarcinoma 1.532 0.001
ovarian cancer 1.900 0.000
pancreatic cancer 1.500 0.001

Synonym

Accession Q495W5 Q495W7 Q8IYE4
Symbols

Gene

PANTHER Protein Class (2)

Gene RIF (2)

PMID Text
24318988 FUT11's expression might be potentially used as a biomarker of disease progression in clear cell renal cell carcinoma
19088067 Activity, splice variants, conserved peptide motifs, and phylogeny of two new alpha1,3-fucosyltransferase families (FUT10 and FUT11).

AA Sequence

MAAGPIRVVLVLLGVLSVCAASGHGSVAEREAGGEAEWAEPWDGAVFRPPSALGAVGVTRSSGTPRPGRE      1 - 70
EAGDLPVLLWWSPGLFPHFPGDSERIECARGACVASRNRRALRDSRTRALLFYGTDFRASAAPLPRLAHQ     71 - 140
SWALLHEESPLNNFLLSHGPGIRLFNLTSTFSRHSDYPLSLQWLPGTAYLRRPVPPPMERAEWRRRGYAP    141 - 210
LLYLQSHCDVPADRDRYVRELMRHIPVDSYGKCLQNRELPTARLQDTATATTEDPELLAFLSRYKFHLAL    211 - 280
ENAICNDYMTEKLWRPMHLGAVPVYRGSPSVRDWMPNNHSVILIDDFESPQKLAEFIDFLDKNDEEYMKY    281 - 350
LAYKQPGGITNQFLLDSLKHREWGVNDPLLPNYLNGFECFVCDYELARLDAEKAHAASPGDSPVFEPHIA    351 - 420
QPSHMDCPVPTPGFGNVEEIPENDSWKEMWLQDYWQGLDQGEALTAMIHNNETEQTKFWDYLHEIFMKRQ    421 - 490
HL                                                                        491 - 492
//

Publication (9)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
24318988 2014 FUT11 as a potential biomarker of clear cell renal cell carcinoma progression based on meta-analysis of gene expression data.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
19159218 2009 Glycoproteomics analysis of human liver tissue by combination of multiple enzyme digestion and hydrazide chemistry.
19088067 2009 Activity, splice variants, conserved peptide motifs, and phylogeny of two new alpha1,3-fucosyltransferase families (FUT10 and FUT11).
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11698403 2002 Composition of Drosophila melanogaster proteome involved in fucosylated glycan metabolism.