Property Summary

NCBI Gene PubMed Count 6
PubMed Score 0.21
PubTator Score 0.04

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (6)

Disease log2 FC p
adult high grade glioma -1.500 6.0e-04
atypical teratoid / rhabdoid tumor -1.300 3.3e-06
glioblastoma -1.500 5.7e-05
lung adenocarcinoma 1.600 6.2e-06
medulloblastoma, large-cell -1.400 2.7e-05
non primary Sjogren syndrome sicca 1.300 1.4e-02

AA Sequence

MGNSHCVPQAPRRLRASFSRKPSLKGNREDSARMSAGLPGPEAARSGDAAANKLFHYIPGTDILDLENQR      1 - 70
ENLEQPFLSVFKKGRRRVPVRNLGKVVHYAKVQLRFQHSQDVSDCYLELFPAHLYFQAHGSEGLTFQGLL     71 - 140
PLTELSVCPLEGSREHAFQITGVWDASRAPRGTPDPGLGEGPALWLRSTCVYVCALSALPAGPLPAPLLV    141 - 210
LCPSRAELDRWLYHLEKQTALLGGPRRCHSAPPQGSCGDELPWTLQRRLTRLRTASGHEPGGSAVCASRV    211 - 280
KLQHLPAQEQWDRLLVLYPTSLAIFSEELDGLCFKGELPLRAVHINLEEKEKQIRSFLIEGPLINTIRVV    281 - 350
CASYEDYGHWLLCLRAVTHREGAPPLPGAESFPGSQVMGSGRGSLSSGGQTSWDSGCLAPPSTRTSHSLP    351 - 420
ESSVPSTVGCSSQHTPDQANSDRASIGRRRTELRRSGSSRSPGSKARAEGRGPVTPLHLDLTQLHRLSLE    421 - 490
SSPDAPDHTSETSHSPLYADPYTPPATSHRRVTDVRGLEEFLSAMQSARGPTPSSPLPSVPVSVPASDPR    491 - 560
SCSSGPAGPYLLSKKGALQSRAAQRHRGSAKDGGPQPPDAPQLVSSAREGSPEPWLPLTDGRSPRRSRDP    561 - 630
GYDHLWDETLSSSHQKCPQLGGPEASGGLVQWI                                         631 - 663
//

Text Mined References (11)

PMID Year Title