Property Summary

NCBI Gene PubMed Count 6
PubMed Score 0.10
PubTator Score 0.04

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (6)

Disease log2 FC p
atypical teratoid / rhabdoid tumor -1.300 0.000
glioblastoma -1.500 0.000
medulloblastoma, large-cell -1.400 0.000
adult high grade glioma -1.500 0.001
non primary Sjogren syndrome sicca 1.300 0.014
lung adenocarcinoma 1.600 0.000

AA Sequence

MGNSHCVPQAPRRLRASFSRKPSLKGNREDSARMSAGLPGPEAARSGDAAANKLFHYIPGTDILDLENQR      1 - 70
ENLEQPFLSVFKKGRRRVPVRNLGKVVHYAKVQLRFQHSQDVSDCYLELFPAHLYFQAHGSEGLTFQGLL     71 - 140
PLTELSVCPLEGSREHAFQITGVWDASRAPRGTPDPGLGEGPALWLRSTCVYVCALSALPAGPLPAPLLV    141 - 210
LCPSRAELDRWLYHLEKQTALLGGPRRCHSAPPQGSCGDELPWTLQRRLTRLRTASGHEPGGSAVCASRV    211 - 280
KLQHLPAQEQWDRLLVLYPTSLAIFSEELDGLCFKGELPLRAVHINLEEKEKQIRSFLIEGPLINTIRVV    281 - 350
CASYEDYGHWLLCLRAVTHREGAPPLPGAESFPGSQVMGSGRGSLSSGGQTSWDSGCLAPPSTRTSHSLP    351 - 420
ESSVPSTVGCSSQHTPDQANSDRASIGRRRTELRRSGSSRSPGSKARAEGRGPVTPLHLDLTQLHRLSLE    421 - 490
SSPDAPDHTSETSHSPLYADPYTPPATSHRRVTDVRGLEEFLSAMQSARGPTPSSPLPSVPVSVPASDPR    491 - 560
SCSSGPAGPYLLSKKGALQSRAAQRHRGSAKDGGPQPPDAPQLVSSAREGSPEPWLPLTDGRSPRRSRDP    561 - 630
GYDHLWDETLSSSHQKCPQLGGPEASGGLVQWI                                         631 - 663
//

Text Mined References (11)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
25043870 2014 Cell-free identification of novel N-myristoylated proteins from complementary DNA resources using bioorthogonal myristic acid analogues.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
16381901 2006 The LIFEdb database in 2006.
15489336 2004 From ORFeome to biology: a functional genomics pipeline.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11230166 2001 Toward a catalog of human genes and proteins: sequencing and analysis of 500 novel complete protein coding human cDNAs.
More...