Property Summary

NCBI Gene PubMed Count 10
PubMed Score 35.79
PubTator Score 17.22

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (20)

Disease log2 FC p
adult high grade glioma 1.300 1.9e-02
astrocytoma 2.000 3.6e-02
Astrocytoma, Pilocytic 2.300 3.9e-09
Barrett's esophagus 2.000 2.2e-02
chronic lymphosyte leukemia -1.400 2.3e-07
cutaneous lupus erythematosus 1.100 3.1e-02
Down syndrome 1.200 4.4e-03
esophageal adenocarcinoma 2.300 1.8e-02
glioblastoma 2.800 2.8e-04
head and neck cancer and chronic obstruc... 1.400 1.5e-03
interstitial cystitis 1.300 1.1e-02
lung cancer -1.600 1.4e-04
lung carcinoma 2.100 3.4e-23
nephrosclerosis -1.308 2.6e-02
ovarian cancer -3.400 2.3e-08
pancreatic cancer 1.700 3.0e-03
pancreatic ductal adenocarcinoma liver m... -2.639 1.6e-02
periodontitis 1.300 1.9e-25
primary Sjogren syndrome 1.100 4.7e-03
tuberculosis 1.900 2.5e-02

Gene RIF (2)

AA Sequence

MTQNTVIVNGVAMASRPSQPTHVNVHIHQESALTQLLKAGGSLKKFLFHPGDTVPSTARIGYEQLALGVT      1 - 70
QILLGVVSCVLGVCLSLGPWTVLSASGCAFWAGSVVIAAGAGAIVHEKHPGKLAGYISSLLTLAGFATAM     71 - 140
AAVVLCVNSFIWQTEPFLYIDTVCDRSDPVFPTTGYRWMRRSQENQWQKEECRAYMQMLRKLFTAIRALF    141 - 210
LAVCVLKVIVSLVSLGVGLRNLCGQSSQPLNEEGSEKRLLGENSVPPSPSREQTSTAIVL              211 - 270
//

Text Mined References (12)

PMID Year Title