Property Summary

NCBI Gene PubMed Count 9
PubMed Score 31.97
PubTator Score 17.22

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (20)

Disease log2 FC p
nephrosclerosis -1.308 0.026
Barrett's esophagus 2.000 0.022
esophageal adenocarcinoma 2.300 0.018
cutaneous lupus erythematosus 1.100 0.031
glioblastoma 2.800 0.000
chronic lymphosyte leukemia -1.400 0.000
astrocytoma 2.000 0.036
periodontitis 1.300 0.000
tuberculosis 1.900 0.025
pancreatic ductal adenocarcinoma liver m... -2.639 0.016
lung cancer -1.600 0.000
interstitial cystitis 1.300 0.011
adult high grade glioma 1.300 0.019
pilocytic astrocytoma 2.300 0.000
primary Sjogren syndrome 1.100 0.005
lung carcinoma 2.100 0.000
ovarian cancer -3.400 0.000
Down syndrome 1.200 0.004
pancreatic cancer 1.700 0.003
head and neck cancer and chronic obstruc... 1.400 0.002

Synonym

Accession Q3YBM2 B2RDK2 D3DWZ7 E9PAV4 Q5BJI2 Q9BT42 Q9Y609
Symbols LR8
MS4B2

Gene

PANTHER Protein Class (1)

Gene RIF (1)

PMID Text
22244448 human TMEM176A and 176B protein levels are significantly elevated in lymphoma, but not in normal tissues

AA Sequence

MTQNTVIVNGVAMASRPSQPTHVNVHIHQESALTQLLKAGGSLKKFLFHPGDTVPSTARIGYEQLALGVT      1 - 70
QILLGVVSCVLGVCLSLGPWTVLSASGCAFWAGSVVIAAGAGAIVHEKHPGKLAGYISSLLTLAGFATAM     71 - 140
AAVVLCVNSFIWQTEPFLYIDTVCDRSDPVFPTTGYRWMRRSQENQWQKEECRAYMQMLRKLFTAIRALF    141 - 210
LAVCVLKVIVSLVSLGVGLRNLCGQSSQPLNEEGSEKRLLGENSVPPSPSREQTSTAIVL              211 - 270
//

Text Mined References (11)

PMID Year Title
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
22244448 2012 Abnormal accumulation of human transmembrane (TMEM)-176A and 176B proteins is associated with cancer pathology.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
16095493 2005 Identification of a new member of the CD20/FcepsilonRIbeta family overexpressed in tolerated allografts.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15342556 2004 Sequence comparison of human and mouse genes reveals a homologous block structure in the promoter regions.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12853948 2003 The DNA sequence of human chromosome 7.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11967007 2002 Gene expression profile of renal proximal tubules regulated by proteinuria.
More...