Property Summary

NCBI Gene PubMed Count 6
PubMed Score 0.85
PubTator Score 1.17

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
psoriasis 6694 4.9e-178
mucosa-associated lymphoid tissue lymphoma 484 8.0e-03
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 1.0
Kidney cancer 2613 0.0 0.6

Expression

  Differential Expression (2)

Disease log2 FC p
mucosa-associated lymphoid tissue lympho... -1.048 8.0e-03
psoriasis -4.500 4.9e-178

Gene RIF (2)

AA Sequence

MAGQRVLLLVGFLLPGVLLSEAAKILTISTVGGSHYLLMDRVSQILQDHGHNVTMLNHKRGPFMPDFKKE      1 - 70
EKSYQVISWLAPEDHQREFKKSFDFFLEETLGGRGKFENLLNVLEYLALQCSHFLNRKDIMDSLKNENFD     71 - 140
MVIVETFDYCPFLIAEKLGKPFVAILSTSFGSLEFGLPIPLSYVPVFRSLLTDHMDFWGRVKNFLMFFSF    141 - 210
CRRQQHMQSTFDNTIKEHFTEGSRPVLSHLLLKAELWFINSDFAFDFARPLLPNTVYVGGLMEKPIKPVP    211 - 280
QDLENFIAKFGDSGFVLVTLGSMVNTCQNPEIFKEMNNAFAHLPQGVIWKCQCSHWPKDVHLAANVKIVD    281 - 350
WLPQSDLLAHPSIRLFVTHGGQNSIMEAIQHGVPMVGIPLFGDQPENMVRVEAKKFGVSIQLKKLKAETL    351 - 420
ALKMKQIMEDKRYKSAAVAASVILRSHPLSPTQRLVGWIDHVLQTGGATHLKPYVFQQPWHEQYLLDVFV    421 - 490
FLLGLTLGTLWLCGKLLGMAVWWLRGARKVKET                                         491 - 523
//

Text Mined References (10)

PMID Year Title