Property Summary

NCBI Gene PubMed Count 4
PubMed Score 0.37
PubTator Score 0.17

Knowledge Summary

Patent

No data available

AA Sequence

MSYNCCSRNFSSCSHGGYLHYPGSSCGSSYPSNLVYSTDLCSPSTCQLGSSLYRGCQETCWRPNSCQTLC      1 - 70
VESSPCHTSCYYPRTHMLCNSCLTMHVGSRGFGSNSCCSLSCGSRSCSSLGCGSNGFRYLNYRIHTSPSQ     71 - 140
SYRSRFCHPIYFPPRRWFHSSCYQPFCRSGFY                                          141 - 172
//

Text Mined References (4)

PMID Year Title