Property Summary

NCBI Gene PubMed Count 3
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
psoriasis 6694 5.2e-04

Expression

  Differential Expression (1)

Disease log2 FC p
psoriasis -1.100 5.2e-04

 Compartment GO Term (0)

AA Sequence

MYKSWTLGDPKEKEGVGNILEETKRTQNNTEQASRAINSPLQSPYTDSMKALAISSHWFLPQIHTLPPIT      1 - 70
KATRHRWPPACCGRRGGQTTLPPLTPIVRACESMERSCPGNYPMQHERKVMQRHPTLR                 71 - 128
//

Text Mined References (4)

PMID Year Title