Property Summary

NCBI Gene PubMed Count 12
PubMed Score 34.39
PubTator Score 1.00

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (5)

Disease log2 FC p
intraductal papillary-mucinous adenoma (... 6.500 1.2e-04
intraductal papillary-mucinous neoplasm ... 4.200 1.7e-02
lung carcinoma -1.400 1.5e-14
ovarian cancer -1.100 2.2e-04
pancreatic cancer 3.400 5.5e-05

Gene RIF (3)

AA Sequence

MAQPVHSLCSAFGLQCCLLFLLASWGAGATTFQEYQKTGELSTSDHIFPLTPGLVYSIPFDHIVLHSGQR      1 - 70
PPELPKSTEIHEQKRHCNTTRHSKPTDKPTGNSKTIDHKSSTDNHEAPPTSEENSSNQGKDPMIRNQRSV     71 - 140
DPADSTTTHKESAGKKHITPAPKSKINCRKSTTGKSTVTRKSDKTGRPLEKSMSTLDKTSTSSHKTTTSF    141 - 210
HNSGNSQTKQKSTSFPEKITAASKTTYKTTGTPEESEKTEDSRTTVASDKLLTKTTKNIQETISANELTQ    211 - 280
SLAEPTEHGGRTANENNTPSPAEPTENRERTANENKKTICTKGKNTPVPEKPTENLGNTTLTTETIKAPV    281 - 350
KSTENPEKTAAVTKTIKPSVKVTGDKSLTTTSSHLNKTEVTHQVPTGSFTLITSRTKLSSITSEATGNES    351 - 420
HPYLNKDGSQKGIHAGQMGENDSFPAWAIVIVVLVAVILLLVFLGLIFLVSYMMRTRRTLTQNTQYNDAE    421 - 490
DEGGPNSYPVYLMEQQNLGMGQIPSPR                                               491 - 517
//

Text Mined References (15)

PMID Year Title