Property Summary

NCBI Gene PubMed Count 0
PubMed Score 0.10

Knowledge Summary

Patent

No data available

AA Sequence

MPHSHCHSLRSFHNAPPLSAITHGTNPITFEDRLCLPSSFHSRTCFLDNFQETCNETTSCQMTNCEQDLF      1 - 70
TDDSCVQSNCFPGVVQTTYSNSRPCERTACQSESSSAGLACVSQPCQSESTQQMGFVAQSCQPASLKGNS     71 - 140
CPPKTSKSKNFETLERASSQCQCQSQNPESSSCRPLVNVAPEPQLLESSPGVEPTCCVTGGSQLPSK       141 - 207
//