Property Summary

NCBI Gene PubMed Count 2
PubMed Score 0.00

Knowledge Summary

Patent

No data available

AA Sequence

MSYYGNYYGGLGYGYDCKYSYTSGFGAFRILDCGYRCGCGGVWI                                1 - 44
//

Text Mined References (2)

PMID Year Title