Property Summary

NCBI Gene PubMed Count 12
PubMed Score 5.89
PubTator Score 6.28

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (3)

Disease Target Count
Fibrinogen Adverse Event 20
Disease Target Count P-value
Breast cancer 3099 1.80889452164612E-23
psoriasis 6685 2.94429186212956E-10
juvenile dermatomyositis 1189 2.39916179949302E-9
ovarian cancer 8492 7.458989235408E-9
ependymoma 2514 2.84585118388812E-7
pediatric high grade glioma 2712 5.83570604542751E-7
Pick disease 1893 9.83425696038958E-7
glioblastoma 5572 4.59311044928243E-6
atypical teratoid / rhabdoid tumor 4369 4.63755148222308E-6
pilocytic astrocytoma 3086 8.19388393718194E-6
acute quadriplegic myopathy 1157 3.92650129090524E-5
dermatomyositis 967 1.68507752556423E-4
lung cancer 4473 2.10882023692103E-4
tuberculosis 1563 2.54435130720939E-4
osteosarcoma 7933 4.68138983205447E-4
invasive ductal carcinoma 2950 9.00041652892816E-4
intraductal papillary-mucinous adenoma (IPMA) 2956 0.00121447596520915
medulloblastoma, large-cell 6234 0.00278849277725574
primitive neuroectodermal tumor 3031 0.00703598620884353
oligodendroglioma 2849 0.0107364472142495
adrenocortical carcinoma 1427 0.0180389965010209
non primary Sjogren syndrome sicca 840 0.0188612984512572
Rheumatoid Arthritis 1171 0.0212789928921736
Waldenstrons macroglobulinemia 765 0.0304935693963687
astrocytic glioma 2241 0.0351971728012792
acute myeloid leukemia 785 0.0443467020198768
Disease Target Count Z-score Confidence
Gamma chain deficiency 7 3.236 1.6

Expression

  Differential Expression (26)

Disease log2 FC p
Rheumatoid Arthritis 1.500 0.021
Waldenstrons macroglobulinemia 1.258 0.030
astrocytic glioma 1.100 0.035
ependymoma 1.200 0.000
oligodendroglioma 2.400 0.011
osteosarcoma 2.425 0.000
glioblastoma 2.000 0.000
atypical teratoid / rhabdoid tumor 1.400 0.000
medulloblastoma, large-cell -1.900 0.003
primitive neuroectodermal tumor 1.100 0.007
acute quadriplegic myopathy 1.019 0.000
juvenile dermatomyositis 1.229 0.000
adrenocortical carcinoma 1.006 0.018
tuberculosis -1.400 0.000
intraductal papillary-mucinous adenoma (... 1.600 0.001
lung cancer -1.600 0.000
pediatric high grade glioma 1.800 0.000
pilocytic astrocytoma 1.200 0.000
non primary Sjogren syndrome sicca -1.300 0.019
acute myeloid leukemia 1.800 0.044
psoriasis -1.400 0.000
Pick disease 1.300 0.000
Breast cancer -1.500 0.000
invasive ductal carcinoma -1.300 0.001
ovarian cancer -2.600 0.000
dermatomyositis 1.200 0.000

Synonym

Accession Q3L8U1 B2RTU2 B9ZVQ0 O15025 Q1WF12 Q6DTK9 Q9H9V7 Q9UHM2 CHD-9
Symbols AD013
CHD-9
CReMM
KISH2
PRIC320

Gene

  Ortholog (8)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Dog OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Platypus OMA EggNOG Inparanoid
Anole lizard OMA Inparanoid
Xenopus OMA Inparanoid

Gene RIF (5)

PMID Text
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
16705189 Chromatin immunoprecipitation assay was applied to follow the dynamics of CReMM binding to A/T-rich regions on promoters of genes that play a role in osteoblast maturation.
16523501 CReMM is a chromodomain helicase-DNA-binding protein expressed by osteoprogenitors[CReMM]
16523501 CReMM is a chromodomain helicase-DNA-binding protein expressed by osteoprogenitors
16095617 The CHD9 (CReMM) protein is extensively phosphorylated, has DNA-dependent ATPase activity, and binds to A/T-rich DNA. It is also expressed in mesenchymal progenitors.

AA Sequence

MTDPMMDFFDDANLFGETLEGLSDDAFVQPGPVSLVDELNLGAEFEPLHIDSLNHVQGTPTHQKMTDFEQ      1 - 70
LNQFDSIKFHHVNQSFGSPAEHVLSPHSQFNCSPIHPQNQPNGLFPDVSDGSPMWGHQTATTISNQNGSP     71 - 140
FHQQGHSHSMHQNKSFVAHHDFALFQANEQQTQCTSLRSQQNRNNLNPGQNSLSQSKNFMNVSGPHRVNV    141 - 210
NHPPQMTNASNSQQSISMQQFSQTSNPSAHFHKCSSHQEGNFNGPSPNMTSCSVSNSQQFSSHYSFSSNH    211 - 280
ISPNSLLQSSAVLASNHTNQTLSDFTGSNSFSPHRGIKQESTQHILNPNTSLNSNNFQILHSSHPQGNYS    281 - 350
NSKLSPVHMNFPDPVDSGTQMGHFNDHVETNGFSSLEENLLHQVESQTEPFTGLDPEDLLQEGLLPHFDE    351 - 420
STFGQDNSSHILDHDLDRQFTSHLVTRPSDMAQTQLQSQARSWHSSFSNHQHLHDRNHLCLQRQPPSSKK    421 - 490
SDGSGTYTKLQNTQVRVMSEKKQRKKVESESKQEKANRIISEAIAKAKERGERNIPRVMSPENFPTASVE    491 - 560
GKEEKKGRRMKSKPKDKDSKKTKTCSKLKEKTKIGKLIITLGKKQKRKNESSDEISDAEQMPQHTLKDQD    561 - 630
SQKRRSNRQIKRKKYAEDIEGKQSEEEVKGSMKIKKNSAPLPGEQPLQLFVENPSEEDAAIVDKILSSRT    631 - 700
VKKEISPGVMIDTEEFFVKYKNYSYLHCEWATEEQLLKDKRIQQKIKRFKLRQAQRAHFFADMEEEPFNP    701 - 770
DYVEVDRVLEVSFCEDKDTGEPVIYYLVKWCSLPYEDSTWELKEDVDLAKIEEFEQLQASRPDTRRLDRP    771 - 840
PSNIWKKIDQSRDYKNGNQLREYQLEGLNWLLFNWYNRRNCILADEMGLGKTIQSITFLYEILLTGIRGP    841 - 910
FLIIAPLSTIANWEREFRTWTDINVVVYHGSLISRQMIQQYEMYFRDSQGRIIRGAYRFQAIITTFEMIL    911 - 980
GGCGELNAIEWRCVIIDEAHRLKNKNCKLLEGLKLMNLEHKVLLTGTPLQNTVEELFSLLHFLEPLRFPS    981 - 1050
ESTFMQEFGDLKTEEQVQKLQAILKPMMLRRLKEDVEKKLAPKEETIIEVELTNIQKKYYRAILEKNFSF   1051 - 1120
LSKGAGQTNVPNLVNTMMELRKCCNHPYLIKGAEEKILGEFRDTYNPAASDFHLQAMIQSAGKLVLIDKL   1121 - 1190
LPKMKAGGHKVLIFSQMVRCLDILEDYLIHKRYLYERIDGRVRGNLRQAAIDRFSKPDSDRFVFLLCTRA   1191 - 1260
GGLGINLTAADTCIIFDSDWNPQNDLQAQARCHRIGQNKAVKVYRLVTRNSYEREMFDRASLKLGLDKAV   1261 - 1330
LQSMSGRESNVGGIQQLSKKEIEDLLRRGAYGAIMEEEDEGSKFCEEDIDQILLRRTKTITIESEGRGST   1331 - 1400
FAKASFVASGNRTDISLDDPNFWQKWAKKAEIDIEAISGRNSLVIDTPRIRKQTRPFSATKDELAELSEA   1401 - 1470
ESEGDEKPKLRRPCDRSNGYGRTECFRVEKNLLVYGWGRWREILSHGRFKRQLNEHDVEIICRALLAYCL   1471 - 1540
VHYRGDEKIKGFIWDLITPTEDGQTRELQNHLGLSAPVPRGRKGKKVKTQTSSFDIQKAEWLRKYNPEQL   1541 - 1610
LQDEGYKKHIKHHCNKVLLRVRMLYYLKQEVIGNECQKVFDGVDASDIDVWVPEPDHSEVPAEWWDFDAD   1611 - 1680
KSLLIGVFKHGYEKYNTIRADPALCFLERVGKPDEKAVAAEQRANDYMDGDVEDPEYKPAPAIFKDDIED   1681 - 1750
DVSSPGDLVIADGDGQLMEGDKVYWPTQSALTTRLRRLITAYQRTNKNRQIQQIQPTFSVPTSVMQPIYE   1751 - 1820
EATLNPKMAAKIERQQRWTRREEADFYRVVSTFGVVFDPDRGQFDWTKFRAMARLHKKTDDSLEKYLYAF   1821 - 1890
MSMCRRVCRLPSKEELVDPNIFIQPITEERASRTLYRIELLRKVREQALRHPQLFERLKLCHPNPDLPVW   1891 - 1960
WECGPHDRDLLIGAAKHGVSRTDYHILRDPELSFMAAQRNYSQSKMAHSRTSTPLLQQYQVALSASPLTS   1961 - 2030
LPRLLDAKGIILEEMKVKSENLKEEPQSSEEESMSSVETRTLIKSEPVSPKNGVLPQATGDQKSGGKCET   2031 - 2100
DRRMVAARTEPLTPNPASKKPRVHKRGSESSSDSDSDSERSSCSSRSSSSSSSSSCSHSRSGSSSSSSSS   2101 - 2170
CSSASSSSSSSTSSSSSSSSSSSEESDSDEEEAQKRESTTHMKAYDEESVASLSTTQDETQDSFQMNNGT   2171 - 2240
PESAYILQGGYMLAASYWPKDRVMINRLDSICQTVLKGKWPSARRSYDANTVASFYTTKLLDSPGAATEY   2241 - 2310
SDPSVPTPPGAGVKEEHDQSTQMSKVKKHVREKEFTVKIKDEGGLKLTFQKQGLAQKRPFDGEDGALGQQ   2311 - 2380
QYLTRLRELQSASETSLVNFPKSIPVSGTSIQPTLGANGVILDNQPIVKKRRGRRKNVEGVDIFFFNRNK   2381 - 2450
PPNHVSLGLTSSQISTGINPALSYTQPQGIPDTESPVPVINLKDGTRLAGDDAPKRKDLEKWLKEHPGYV   2451 - 2520
EDLGAFIPRMQLHEGRPKQKRHRCRNPNKLDVNSLTGEERVQLINRRNARKVGGAFAPPLKDLCRFLKEN   2521 - 2590
SEYGVAPEWGDVVKQSGFLPESMYERILTGPVVREEVSRRGRRPKSGIAKATAAAAAASATSVSGNPLLA   2591 - 2660
NGLLPGVDLTTLQALQQNLQNLQSLQVTAGLMGMPTGLPSGGEAKNMAAMFPMLLSGMAGLPNLLGMGGL   2661 - 2730
LTKPTESGTEDKKGSDSKESEGKTERTESQSSENGGENSVSSSPSTSSTAALNTAAAANPLALNPLLLSN   2731 - 2800
ILYPGMLLTPGLNLHIPTLSQSNTFDVQNKNSDLGSSKSVEVKEEDSRIKDQEDKGGTEPSPLNENSTDE   2801 - 2870
GSEKADASSGSDSTSSSSEDSDSSNED                                              2871 - 2897
//

Text Mined References (22)

PMID Year Title
25772364 2015 SUMO-2 Orchestrates Chromatin Modifiers in Response to DNA Damage.
25218447 2014 Uncovering global SUMOylation signaling networks in a site-specific manner.
23969696 2013 Multiethnic meta-analysis of genome-wide association studies in >100 000 subjects identifies 23 fibrinogen-associated Loci but no strong evidence of a causal association between circulating fibrinogen and cardiovascular disease.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19608861 2009 Lysine acetylation targets protein complexes and co-regulates major cellular functions.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
More...