Property Summary

NCBI Gene PubMed Count 12
PubMed Score 7.77
PubTator Score 6.28

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (26)

Disease log2 FC p
acute myeloid leukemia 1.800 4.4e-02
acute quadriplegic myopathy 1.019 3.9e-05
adrenocortical carcinoma 1.006 1.8e-02
adult high grade glioma 1.600 2.7e-05
astrocytic glioma 1.100 3.5e-02
Astrocytoma, Pilocytic 1.200 2.5e-06
atypical teratoid / rhabdoid tumor 1.400 4.6e-06
Breast cancer -1.200 3.3e-13
dermatomyositis 1.200 1.7e-04
ependymoma 1.100 4.4e-02
glioblastoma 1.800 5.3e-08
intraductal papillary-mucinous adenoma (... 1.600 1.2e-03
invasive ductal carcinoma -1.300 9.0e-04
juvenile dermatomyositis 1.229 2.4e-09
lung cancer -1.200 8.9e-03
medulloblastoma, large-cell -1.900 2.8e-03
non primary Sjogren syndrome sicca -1.300 1.9e-02
oligodendroglioma 1.700 7.0e-03
osteosarcoma 1.619 1.3e-05
ovarian cancer -1.800 4.7e-06
Pick disease 1.300 9.8e-07
primitive neuroectodermal tumor 1.100 7.0e-03
psoriasis -1.400 2.9e-10
Rheumatoid arthritis 1.500 2.1e-02
tuberculosis -1.400 2.5e-04
Waldenstrons macroglobulinemia 1.258 3.0e-02

Gene RIF (5)

AA Sequence

MTDPMMDFFDDANLFGETLEGLSDDAFVQPGPVSLVDELNLGAEFEPLHIDSLNHVQGTPTHQKMTDFEQ      1 - 70
LNQFDSIKFHHVNQSFGSPAEHVLSPHSQFNCSPIHPQNQPNGLFPDVSDGSPMWGHQTATTISNQNGSP     71 - 140
FHQQGHSHSMHQNKSFVAHHDFALFQANEQQTQCTSLRSQQNRNNLNPGQNSLSQSKNFMNVSGPHRVNV    141 - 210
NHPPQMTNASNSQQSISMQQFSQTSNPSAHFHKCSSHQEGNFNGPSPNMTSCSVSNSQQFSSHYSFSSNH    211 - 280
ISPNSLLQSSAVLASNHTNQTLSDFTGSNSFSPHRGIKQESTQHILNPNTSLNSNNFQILHSSHPQGNYS    281 - 350
NSKLSPVHMNFPDPVDSGTQMGHFNDHVETNGFSSLEENLLHQVESQTEPFTGLDPEDLLQEGLLPHFDE    351 - 420
STFGQDNSSHILDHDLDRQFTSHLVTRPSDMAQTQLQSQARSWHSSFSNHQHLHDRNHLCLQRQPPSSKK    421 - 490
SDGSGTYTKLQNTQVRVMSEKKQRKKVESESKQEKANRIISEAIAKAKERGERNIPRVMSPENFPTASVE    491 - 560
GKEEKKGRRMKSKPKDKDSKKTKTCSKLKEKTKIGKLIITLGKKQKRKNESSDEISDAEQMPQHTLKDQD    561 - 630
SQKRRSNRQIKRKKYAEDIEGKQSEEEVKGSMKIKKNSAPLPGEQPLQLFVENPSEEDAAIVDKILSSRT    631 - 700
VKKEISPGVMIDTEEFFVKYKNYSYLHCEWATEEQLLKDKRIQQKIKRFKLRQAQRAHFFADMEEEPFNP    701 - 770
DYVEVDRVLEVSFCEDKDTGEPVIYYLVKWCSLPYEDSTWELKEDVDLAKIEEFEQLQASRPDTRRLDRP    771 - 840
PSNIWKKIDQSRDYKNGNQLREYQLEGLNWLLFNWYNRRNCILADEMGLGKTIQSITFLYEILLTGIRGP    841 - 910
FLIIAPLSTIANWEREFRTWTDINVVVYHGSLISRQMIQQYEMYFRDSQGRIIRGAYRFQAIITTFEMIL    911 - 980
GGCGELNAIEWRCVIIDEAHRLKNKNCKLLEGLKLMNLEHKVLLTGTPLQNTVEELFSLLHFLEPLRFPS    981 - 1050
ESTFMQEFGDLKTEEQVQKLQAILKPMMLRRLKEDVEKKLAPKEETIIEVELTNIQKKYYRAILEKNFSF   1051 - 1120
LSKGAGQTNVPNLVNTMMELRKCCNHPYLIKGAEEKILGEFRDTYNPAASDFHLQAMIQSAGKLVLIDKL   1121 - 1190
LPKMKAGGHKVLIFSQMVRCLDILEDYLIHKRYLYERIDGRVRGNLRQAAIDRFSKPDSDRFVFLLCTRA   1191 - 1260
GGLGINLTAADTCIIFDSDWNPQNDLQAQARCHRIGQNKAVKVYRLVTRNSYEREMFDRASLKLGLDKAV   1261 - 1330
LQSMSGRESNVGGIQQLSKKEIEDLLRRGAYGAIMEEEDEGSKFCEEDIDQILLRRTKTITIESEGRGST   1331 - 1400
FAKASFVASGNRTDISLDDPNFWQKWAKKAEIDIEAISGRNSLVIDTPRIRKQTRPFSATKDELAELSEA   1401 - 1470
ESEGDEKPKLRRPCDRSNGYGRTECFRVEKNLLVYGWGRWREILSHGRFKRQLNEHDVEIICRALLAYCL   1471 - 1540
VHYRGDEKIKGFIWDLITPTEDGQTRELQNHLGLSAPVPRGRKGKKVKTQTSSFDIQKAEWLRKYNPEQL   1541 - 1610
LQDEGYKKHIKHHCNKVLLRVRMLYYLKQEVIGNECQKVFDGVDASDIDVWVPEPDHSEVPAEWWDFDAD   1611 - 1680
KSLLIGVFKHGYEKYNTIRADPALCFLERVGKPDEKAVAAEQRANDYMDGDVEDPEYKPAPAIFKDDIED   1681 - 1750
DVSSPGDLVIADGDGQLMEGDKVYWPTQSALTTRLRRLITAYQRTNKNRQIQQIQPTFSVPTSVMQPIYE   1751 - 1820
EATLNPKMAAKIERQQRWTRREEADFYRVVSTFGVVFDPDRGQFDWTKFRAMARLHKKTDDSLEKYLYAF   1821 - 1890
MSMCRRVCRLPSKEELVDPNIFIQPITEERASRTLYRIELLRKVREQALRHPQLFERLKLCHPNPDLPVW   1891 - 1960
WECGPHDRDLLIGAAKHGVSRTDYHILRDPELSFMAAQRNYSQSKMAHSRTSTPLLQQYQVALSASPLTS   1961 - 2030
LPRLLDAKGIILEEMKVKSENLKEEPQSSEEESMSSVETRTLIKSEPVSPKNGVLPQATGDQKSGGKCET   2031 - 2100
DRRMVAARTEPLTPNPASKKPRVHKRGSESSSDSDSDSERSSCSSRSSSSSSSSSCSHSRSGSSSSSSSS   2101 - 2170
CSSASSSSSSSTSSSSSSSSSSSEESDSDEEEAQKRESTTHMKAYDEESVASLSTTQDETQDSFQMNNGT   2171 - 2240
PESAYILQGGYMLAASYWPKDRVMINRLDSICQTVLKGKWPSARRSYDANTVASFYTTKLLDSPGAATEY   2241 - 2310
SDPSVPTPPGAGVKEEHDQSTQMSKVKKHVREKEFTVKIKDEGGLKLTFQKQGLAQKRPFDGEDGALGQQ   2311 - 2380
QYLTRLRELQSASETSLVNFPKSIPVSGTSIQPTLGANGVILDNQPIVKKRRGRRKNVEGVDIFFFNRNK   2381 - 2450
PPNHVSLGLTSSQISTGINPALSYTQPQGIPDTESPVPVINLKDGTRLAGDDAPKRKDLEKWLKEHPGYV   2451 - 2520
EDLGAFIPRMQLHEGRPKQKRHRCRNPNKLDVNSLTGEERVQLINRRNARKVGGAFAPPLKDLCRFLKEN   2521 - 2590
SEYGVAPEWGDVVKQSGFLPESMYERILTGPVVREEVSRRGRRPKSGIAKATAAAAAASATSVSGNPLLA   2591 - 2660
NGLLPGVDLTTLQALQQNLQNLQSLQVTAGLMGMPTGLPSGGEAKNMAAMFPMLLSGMAGLPNLLGMGGL   2661 - 2730
LTKPTESGTEDKKGSDSKESEGKTERTESQSSENGGENSVSSSPSTSSTAALNTAAAANPLALNPLLLSN   2731 - 2800
ILYPGMLLTPGLNLHIPTLSQSNTFDVQNKNSDLGSSKSVEVKEEDSRIKDQEDKGGTEPSPLNENSTDE   2801 - 2870
GSEKADASSGSDSTSSSSEDSDSSNED                                              2871 - 2897
//

Text Mined References (23)

PMID Year Title