Property Summary

NCBI Gene PubMed Count 3
PubMed Score 0.31
PubTator Score 0.22

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (2)

Disease log2 FC p
Pick disease -1.500 0.000
ovarian cancer 1.200 0.000

AA Sequence

MEEQDARVPALEPFRVEQAPPVIYYVPDFISKEEEEYLLRQVFNAPKPKWTQLSGRKLQNWGGLPHPRGM      1 - 70
VPERLPPWLQRYVDKVSNLSLFGGLPANHVLVNQYLPGEGIMPHEDGPLYYPTVSTISLGSHTVLDFYEP     71 - 140
RRPEDDDPTEQPRPPPRPTTSLLLEPRSLLVLRGPAYTRLLHGIAAARVDALDAASSPPNAAACPSARPG    141 - 210
ACLVRGTRVSLTIRRVPRVLRAGLLLGK                                              211 - 238
//

Text Mined References (8)

PMID Year Title
22948820 2012 Lysine methylation of VCP by a member of a novel human protein methyltransferase family.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
17979886 Expression and sub-cellular localization of human ABH family molecules.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15057824 2004 The DNA sequence and biology of human chromosome 19.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.