Property Summary

NCBI Gene PubMed Count 3
PubMed Score 0.31
PubTator Score 0.22

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
Pick disease 1894 1.1e-05
ovarian cancer 8520 1.2e-05
Disease Target Count Z-score Confidence
Embryonal rhabdomyosarcoma 4 4.003 2.0
Alveolar rhabdomyosarcoma 7 3.798 1.9

Expression

  Differential Expression (2)

Disease log2 FC p
ovarian cancer 1.200 1.2e-05
Pick disease -1.500 1.1e-05

AA Sequence

MEEQDARVPALEPFRVEQAPPVIYYVPDFISKEEEEYLLRQVFNAPKPKWTQLSGRKLQNWGGLPHPRGM      1 - 70
VPERLPPWLQRYVDKVSNLSLFGGLPANHVLVNQYLPGEGIMPHEDGPLYYPTVSTISLGSHTVLDFYEP     71 - 140
RRPEDDDPTEQPRPPPRPTTSLLLEPRSLLVLRGPAYTRLLHGIAAARVDALDAASSPPNAAACPSARPG    141 - 210
ACLVRGTRVSLTIRRVPRVLRAGLLLGK                                              211 - 238
//

Text Mined References (8)

PMID Year Title