Property Summary

NCBI Gene PubMed Count 3
PubMed Score 0.31
PubTator Score 0.22

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
Pick disease 1893 1.11984855282309E-5
ovarian cancer 8492 1.19406303193062E-5
Disease Target Count Z-score Confidence
Embryonal rhabdomyosarcoma 4 3.99 2.0
Alveolar rhabdomyosarcoma 7 3.785 1.9

Expression

  Differential Expression (2)

Disease log2 FC p
Pick disease -1.500 0.000
ovarian cancer 1.200 0.000

Synonym

Accession Q3KRA9 A5LGM8 A6NLP1 A8MU96
Symbols ABH6

Gene

  Ortholog (13)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG
Mouse OMA EggNOG Inparanoid
Rat EggNOG Inparanoid
Dog OMA EggNOG Inparanoid
Horse OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Pig OMA EggNOG
Opossum OMA EggNOG Inparanoid
Xenopus OMA EggNOG Inparanoid
Zebrafish OMA EggNOG Inparanoid
C. elegans OMA Inparanoid
Fruitfly EggNOG Inparanoid

AA Sequence

MEEQDARVPALEPFRVEQAPPVIYYVPDFISKEEEEYLLRQVFNAPKPKWTQLSGRKLQNWGGLPHPRGM      1 - 70
VPERLPPWLQRYVDKVSNLSLFGGLPANHVLVNQYLPGEGIMPHEDGPLYYPTVSTISLGSHTVLDFYEP     71 - 140
RRPEDDDPTEQPRPPPRPTTSLLLEPRSLLVLRGPAYTRLLHGIAAARVDALDAASSPPNAAACPSARPG    141 - 210
ACLVRGTRVSLTIRRVPRVLRAGLLLGK                                              211 - 238
//

Text Mined References (8)

PMID Year Title
22948820 2012 Lysine methylation of VCP by a member of a novel human protein methyltransferase family.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
17979886 Expression and sub-cellular localization of human ABH family molecules.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15057824 2004 The DNA sequence and biology of human chromosome 19.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.