Property Summary

NCBI Gene PubMed Count 3
PubMed Score 2.57
PubTator Score 1.48

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (6)

Synonym

Accession Q3KRA6 B7ZLS8 Q4VC35
Symbols AIM29

Gene

 Compartment GO Term (0)

Gene RIF (2)

PMID Text
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20205591 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)

AA Sequence

MAPGEVTITVRLIRSFEHRNFKPVVYHGVNLDQTVKEFIVFLKQDIPLRTNLPPPFRNYKYDALKIIHQA      1 - 70
HKSKTNELVLSLEDDERLLLKEDSTLKAAGIASETEIAFFCEEDYKNYKANPISSW                   71 - 126
//

Publication (7)

PMID Year Title
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
21269460 2011 Initial characterization of the human central proteome.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20205591 2010 Host determinants of HIV-1 control in African Americans.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.