Property Summary

NCBI Gene PubMed Count 3
PubMed Score 2.57
PubTator Score 1.48

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
ovarian cancer 8492 9.73182699250438E-5
pituitary cancer 1972 1.02221045332011E-4
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.001073734162659
intraductal papillary-mucinous carcinoma (IPMC) 2988 0.00251565623132304
medulloblastoma, large-cell 6234 0.00254673187734756
Breast cancer 3099 0.0293159618647445

Expression

  Differential Expression (6)

Synonym

Accession Q3KRA6 B7ZLS8 Q4VC35
Symbols AIM29

Gene

  Ortholog (13)

Species Source
Chimp OMA EggNOG
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG
Horse OMA EggNOG
Cow OMA EggNOG Inparanoid
Pig OMA EggNOG
Opossum OMA EggNOG
Chicken OMA EggNOG Inparanoid
Anole lizard OMA EggNOG
Xenopus OMA EggNOG
Zebrafish OMA EggNOG Inparanoid
S.cerevisiae OMA Inparanoid

 Compartment GO Term (1)

Gene RIF (2)

PMID Text
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20205591 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)

AA Sequence

MAPGEVTITVRLIRSFEHRNFKPVVYHGVNLDQTVKEFIVFLKQDIPLRTNLPPPFRNYKYDALKIIHQA      1 - 70
HKSKTNELVLSLEDDERLLLKEDSTLKAAGIASETEIAFFCEEDYKNYKANPISSW                   71 - 126
//

Text Mined References (7)

PMID Year Title
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
21269460 2011 Initial characterization of the human central proteome.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20205591 2010 Host determinants of HIV-1 control in African Americans.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.