Property Summary

NCBI Gene PubMed Count 3
PubMed Score 2.57
PubTator Score 1.48

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (6)

Disease log2 FC p
Breast cancer 3.100 2.9e-02
intraductal papillary-mucinous carcinoma... -1.400 2.5e-03
intraductal papillary-mucinous neoplasm ... -1.400 1.1e-03
medulloblastoma, large-cell -1.300 2.5e-03
ovarian cancer -1.300 9.7e-05
pituitary cancer 1.200 1.0e-04

Gene RIF (2)

AA Sequence

MAPGEVTITVRLIRSFEHRNFKPVVYHGVNLDQTVKEFIVFLKQDIPLRTNLPPPFRNYKYDALKIIHQA      1 - 70
HKSKTNELVLSLEDDERLLLKEDSTLKAAGIASETEIAFFCEEDYKNYKANPISSW                   71 - 126
//

Text Mined References (7)

PMID Year Title