Property Summary

NCBI Gene PubMed Count 2
PubMed Score 0.11
PubTator Score 0.20

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
tuberculosis 1563 2.00107711503796E-5
pediatric high grade glioma 2712 0.00298286276837251
adrenocortical adenoma 134 0.00383691323744861
glioblastoma 5572 0.0050064326823703
group 3 medulloblastoma 2254 0.00892131212026794
subependymal giant cell astrocytoma 2287 0.0218659039146017

Expression

  Differential Expression (6)

Disease log2 FC p
glioblastoma 1.500 0.005
adrenocortical adenoma 1.008 0.004
tuberculosis 1.300 0.000
pediatric high grade glioma 1.200 0.003
group 3 medulloblastoma 1.200 0.009
subependymal giant cell astrocytoma 1.422 0.022

Synonym

Accession Q3KQV9 A2AMJ8 Q5SPZ2 Q69YQ3 Q6ZR38
Symbols

Gene

PANTHER Protein Class (2)

  Ortholog (8)

Species Source
Chimp OMA EggNOG
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG
Horse OMA EggNOG
Cow OMA EggNOG Inparanoid
Platypus OMA EggNOG Inparanoid
S.cerevisiae OMA Inparanoid

AA Sequence

MASEQDVRARLQRAGQEHLLRFWAELAPEPRAALLAELALLEPEALREHCRRAAEACARPHGPPPDLAAR      1 - 70
LRPLPPERVGRASRSDPETRRRWEEEGFRQISLNKVAVLLLAGGQGTRLGVTYPKGMYRVGLPSRKTLYQ     71 - 140
LQAERIRRVEQLAGERHGTRCTVPWYVMTSEFTLGPTAEFFREHNFFHLDPANVVMFEQRLLPAVTFDGK    141 - 210
VILERKDKVAMAPDGNGGLYCALEDHKILEDMERRGVEFVHVYCVDNILVRLADPVFIGFCVLQGADCGA    211 - 280
KVVEKAYPEEPVGVVCQVDGVPQVVEYSEISPETAQLRASDGSLLYNAGNICNHFFTRGFLKAVTREFEP    281 - 350
LLKPHVAVKKVPYVDEEGNLVKPLKPNGIKMEKFVFDVFRFAKNFAALEVLREEEFSPLKNAEPADRDSP    351 - 420
RTARQALLTQHYRWALRAGARFLDAHGAWLPELPSLPPNGDPPAICEISPLVSYSGEGLEVYLQGREFQS    421 - 490
PLILDEDQAREPQLQES                                                         491 - 507
//

Text Mined References (6)

PMID Year Title
21269460 2011 Initial characterization of the human central proteome.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15164053 2004 DNA sequence and analysis of human chromosome 9.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.