Property Summary

NCBI Gene PubMed Count 3
PubMed Score 0.79

Knowledge Summary

Patent

No data available

Expression

 GO Function (1)

AA Sequence

MSLKPFTYPFPETRFLHAGPNVYKFKIRYGKSIRGEEIENKEVITQELEVPVEKKAVGAVMRKRKHMDEP      1 - 70
SSPSRPGLDRAKIGTSSQGPSKKKPPVETRRNRERKTQQGLQETLASDITDVQKQDSEWGHSLPGRIVPP     71 - 140
LQHNSPPPKERAATGFFGFLSSLFPFRYFFRKSSHS                                      141 - 176
//

Text Mined References (5)

PMID Year Title