Property Summary

NCBI Gene PubMed Count 3
PubMed Score 0.64

Knowledge Summary


No data available



Accession Q3KP22 B3KS99 E9PPE5
Symbols C11orf85


  Ortholog (4)

Species Source
Chimp OMA EggNOG
Rat OMA Inparanoid
Horse OMA EggNOG

 GO Function (1)

AA Sequence

LQHNSPPPKERAATGFFGFLSSLFPFRYFFRKSSHS                                      141 - 176

Text Mined References (5)

PMID Year Title
26548954 2015 MAJIN Links Telomeric DNA to the Nuclear Membrane by Exchanging Telomere Cap.
16554811 2006 Human chromosome 11 DNA sequence and analysis including novel gene identification.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.