Property Summary

NCBI Gene PubMed Count 3
PubMed Score 2.84
PubTator Score 0.50

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
osteosarcoma 7950 1.9e-06
medulloblastoma, large-cell 6241 3.8e-05
Disease Target Count Z-score Confidence
Sertoli cell-only syndrome 37 4.652 2.3
Azoospermia 110 3.61 1.8

Expression

  Differential Expression (2)

Disease log2 FC p
medulloblastoma, large-cell 1.100 3.8e-05
osteosarcoma 1.785 1.9e-06

AA Sequence

MWRLALGGVFLAAAQACVFCRLPAHDLSGRLARLCSQMEARQKECGASPDFSAFALDEVSMNKVTEKTHR      1 - 70
VLRVMEIKEAVSSLPSYWSWLRKTKLPEYTREALCPPACRGSTTLYNCSTCKGTEVSCWPRKRCFPGSQD     71 - 140
LWEAKILLLSIFGAFLLLGVLSLLVESHHLQAKSGL                                      141 - 176
//

Text Mined References (5)

PMID Year Title