Property Summary

NCBI Gene PubMed Count 5
PubMed Score 1.40
PubTator Score 3.07

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.7
Disease Target Count Z-score Confidence
Large cell carcinoma 7 3.248 1.6
Lung large cell carcinoma 6 3.209 1.6

AA Sequence

MVVSAGPWSSEKAEMNILEINEKLRPQLAENKQQFGNLKERCFLTQLAGFLANRQKKYKYEECKDLIKFM      1 - 70
LRNERQFKEEKLAEQLKQAEELRQYKVLVHSQERELTQLKEKLREGRDASRSLNEHLQALLTPDEPDKSQ     71 - 140
GQDLQEQLAEGCRLAQHLVQKLSPENDEDEDEDVQVEEDEKVLESPAPREVQKAEESKVTEDSLEECAIT    141 - 210
CSNSHGPCDSNQPHKNIKITFEEDEVNSTLVVDRESSHDECQDALNILPVPGPTSSATNVSMVVSAGPLS    211 - 280
SEKAEMNILEINEKLRPQLAEKKQQFRNLKEKCFLTQLAGFLANQQNKYKYEECKDLIKFMLRNERQFKE    281 - 350
EKLAEQLKQAEELRQYKVLVHAQERELTQLREKLREGRDASRSLNEHLQALLTPDEPDKSQGQDLQEQLA    351 - 420
EGCRLAQHLVQKLSPENDNDDNEDVQVEVAEKVQKSSAPREMQKAEEKEVPEDSLEECAITYSNSHGPYD    421 - 490
SNQPHRKTKITFEEDKVDSTLIGSSSHVEREDAVHIIPENESDDEEEEEKGPVSPRNLQESEEEEVPQES    491 - 560
WDEGYSTPSIPPEMLASYKSYSSTFHSLEEQQVCMAVDIGRHRWDQVKKEDQEATGPRLSRELLDEKGPE    561 - 630
VLQDSLYRCYSTPSGCLELTDSCQPYRSAFYVLEQQRVGLAVDMDEIEKYQEVEEDQDPSCPRLSRELLD    631 - 700
EKEPEVLQDSLGRWYSTPSGYPELPDLGQPYSSAVYSLEEQYLGLALDLDRIKKDQEEEEDQGPPCPRLS    701 - 770
RELLEVVEPEVLQDSLDRCYSTPSSCLEQPDSWQPYGSSFYALEEKHVGFSLDVGEIEKKGKGKKRRGRR    771 - 840
SKKERRRGRKEGEEDQNPPCPRLNGVLMEVEEPEVLQDSLDGCYSTPSMYFELPDSFQHYRSVFYSFEEQ    841 - 910
HISFALYVDNRFFTLTVTSLHLVFQMEVIFPQ                                          911 - 942
//

Text Mined References (5)

PMID Year Title