Property Summary

NCBI Gene PubMed Count 5
PubMed Score 0.60
PubTator Score 3.07

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (2)

AA Sequence

MVVSAGPWSSEKAEMNILEINEKLRPQLAENKQQFGNLKERCFLTQLAGFLANRQKKYKYEECKDLIKFM      1 - 70
LRNERQFKEEKLAEQLKQAEELRQYKVLVHSQERELTQLKEKLREGRDASRSLNEHLQALLTPDEPDKSQ     71 - 140
GQDLQEQLAEGCRLAQHLVQKLSPENDEDEDEDVQVEEDEKVLESPAPREVQKAEESKVTEDSLEECAIT    141 - 210
CSNSHGPCDSNQPHKNIKITFEEDEVNSTLVVDRESSHDECQDALNILPVPGPTSSATNVSMVVSAGPLS    211 - 280
SEKAEMNILEINEKLRPQLAEKKQQFRNLKEKCFLTQLAGFLANQQNKYKYEECKDLIKFMLRNERQFKE    281 - 350
EKLAEQLKQAEELRQYKVLVHAQERELTQLREKLREGRDASRSLNEHLQALLTPDEPDKSQGQDLQEQLA    351 - 420
EGCRLAQHLVQKLSPENDNDDNEDVQVEVAEKVQKSSAPREMQKAEEKEVPEDSLEECAITYSNSHGPYD    421 - 490
SNQPHRKTKITFEEDKVDSTLIGSSSHVEREDAVHIIPENESDDEEEEEKGPVSPRNLQESEEEEVPQES    491 - 560
WDEGYSTPSIPPEMLASYKSYSSTFHSLEEQQVCMAVDIGRHRWDQVKKEDQEATGPRLSRELLDEKGPE    561 - 630
VLQDSLYRCYSTPSGCLELTDSCQPYRSAFYVLEQQRVGLAVDMDEIEKYQEVEEDQDPSCPRLSRELLD    631 - 700
EKEPEVLQDSLGRWYSTPSGYPELPDLGQPYSSAVYSLEEQYLGLALDLDRIKKDQEEEEDQGPPCPRLS    701 - 770
RELLEVVEPEVLQDSLDRCYSTPSSCLEQPDSWQPYGSSFYALEEKHVGFSLDVGEIEKKGKGKKRRGRR    771 - 840
SKKERRRGRKEGEEDQNPPCPRLNGVLMEVEEPEVLQDSLDGCYSTPSMYFELPDSFQHYRSVFYSFEEQ    841 - 910
HISFALYVDNRFFTLTVTSLHLVFQMEVIFPQ                                          911 - 942
//

Text Mined References (5)

PMID Year Title
22973535 2012 Evolutionary history and genome organization of DUF1220 protein domains.
16079250 2005 A novel gene family NBPF: intricate structure generated by gene duplications during primate evolution.
15252450 2004 Lineage-specific gene duplication and loss in human and great ape evolution.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.