Property Summary

NCBI Gene PubMed Count 9
PubMed Score 3.27
PubTator Score 29.22

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
osteosarcoma 7950 4.2e-08
ulcerative colitis 1819 2.3e-06
ovarian cancer 8520 6.8e-05
medulloblastoma 720 7.5e-05
interstitial cystitis 2312 1.4e-03
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.5

Gene RIF (3)

AA Sequence

MVVSAGPWSSEKAETNILEINEKLRPQLAENKQQFRNLKEKCFVTQLAGFLANRQKKYKYEECKDLIKFM      1 - 70
LRNERQFKEEKLAEQLKQAEELRQYKVLVHSQERELTQLREKLREGRDASRSLNQHLQALLTPDEPDKSQ     71 - 140
GQDLQEQLAEGCRLAQHLVQKLSPENDEDEDEDVQVEEAEKVLESSAPREVQKAEESKVPEDSLEECAIT    141 - 210
CSNSHGPCDSNQPHKNINITFEEDKVNSTLVVDRESSHDECQDAVNILPVPGPTSSATNVSMVVSAGPLS    211 - 280
SEKAEMNILEMNEKLRPQLAEKKQQFRNLKEKCFVTQLAGFLANQQNKYKYEECEDLIKSMLRNERQFKE    281 - 350
EKLAEQLKQAEELRQYKVLVHSQERELTQLREKLREGRDASRSLNQHLQALLTPDEPDKSQGQDLQEQLA    351 - 420
EGCRLAQHLVQKLSPENDEDEDEDVQVEEAEKVLESSAPREVQKAEESKVPEDSLEECAITCSNSHGPCD    421 - 490
SNQPHKNINITFEEDKVNSALVVDRESSHDECQDAVNILPVPGPTSSATNVSMVVSAGPLSSEKAEMNIL    491 - 560
EMNEKLRPQLAEKKQQFRNLKEKCFVTQLACFLANQQNKYKYEECKDLIKSVLRNERQFKEEKLAEQLKQ    561 - 630
AEELRQYKVLVHSQERELTQLREKLREGRDASRSLNQHLQALLTPDEPDKSQGQDLQEQLAEGCRLAQQL    631 - 700
FQKLSPENDNDHDEDVQVEVAEKVQKSSAPREMQKAEEKEVPEDSLEECAITCSNSHGPYDSNQPHRKTK    701 - 770
ITFEEDKVDSTLIGSSSHVEWEDAVHIIPENESDDEEEEEKGPVSPRNLQESEEEEVPQESWDEGYSTLS    771 - 840
IPPEMLASYQSYSGTFHSLEEQQVCMAVDIGGHRWDQVKKEDQEATGPRLSRELLDEKGPEVLQDSLDRC    841 - 910
YSTPSGYLELTDSCQPYRSAFYILEQQRVGWALDMDEIEKYQEVEEDQDPSCPRLSRELLDEKEPEVLQD    911 - 980
SLDRCYSTPSGYLELPDLGQPYRSAVYSLEEQYLGLALDVDRIKKDQEEEEDQGPPCPRLSRELLEAVEP    981 - 1050
EVLQDSLDRCYSTPSSCLEQPDSCLPYGSSFYALEEKHVGFSLDVGEIEKKGKGKKRRGRRSTKKRRRRG   1051 - 1120
RKEGEEDQNPPCPRLSGMLMEVEEPEVLQDSLDRCYSTPSMYFELPDSFQHYRSVFYSFEEQHISFALDV   1121 - 1190
DNRFLTLMGTSLHLVFQMGVIFPQ                                                 1191 - 1214
//

Text Mined References (10)

PMID Year Title