Property Summary

NCBI Gene PubMed Count 9
PubMed Score 3.31
PubTator Score 29.22

Knowledge Summary

Patent

No data available

Gene RIF (3)

PMID Text
26802646 NBPF1 overexpression may be a suppressor for cervical cancer via affecting cell invasion and apoptosis through regulating PI3K/mTOR signaling pathway.
25958384 We demonstrated that NBPF1 exerts different tumor suppressive effects, depending on the cell line analyzed, and provide new clues into the molecular mechanism of the enigmatic NBPF proteins.
20096688 Chibby and clusterin were co-immunoprecipitated with NBPF1.

AA Sequence

MVVSAGPWSSEKAETNILEINEKLRPQLAENKQQFRNLKEKCFVTQLAGFLANRQKKYKYEECKDLIKFM      1 - 70
LRNERQFKEEKLAEQLKQAEELRQYKVLVHSQERELTQLREKLREGRDASRSLNQHLQALLTPDEPDKSQ     71 - 140
GQDLQEQLAEGCRLAQHLVQKLSPENDEDEDEDVQVEEAEKVLESSAPREVQKAEESKVPEDSLEECAIT    141 - 210
CSNSHGPCDSNQPHKNINITFEEDKVNSTLVVDRESSHDECQDAVNILPVPGPTSSATNVSMVVSAGPLS    211 - 280
SEKAEMNILEMNEKLRPQLAEKKQQFRNLKEKCFVTQLAGFLANQQNKYKYEECEDLIKSMLRNERQFKE    281 - 350
EKLAEQLKQAEELRQYKVLVHSQERELTQLREKLREGRDASRSLNQHLQALLTPDEPDKSQGQDLQEQLA    351 - 420
EGCRLAQHLVQKLSPENDEDEDEDVQVEEAEKVLESSAPREVQKAEESKVPEDSLEECAITCSNSHGPCD    421 - 490
SNQPHKNINITFEEDKVNSALVVDRESSHDECQDAVNILPVPGPTSSATNVSMVVSAGPLSSEKAEMNIL    491 - 560
EMNEKLRPQLAEKKQQFRNLKEKCFVTQLACFLANQQNKYKYEECKDLIKSVLRNERQFKEEKLAEQLKQ    561 - 630
AEELRQYKVLVHSQERELTQLREKLREGRDASRSLNQHLQALLTPDEPDKSQGQDLQEQLAEGCRLAQQL    631 - 700
FQKLSPENDNDHDEDVQVEVAEKVQKSSAPREMQKAEEKEVPEDSLEECAITCSNSHGPYDSNQPHRKTK    701 - 770
ITFEEDKVDSTLIGSSSHVEWEDAVHIIPENESDDEEEEEKGPVSPRNLQESEEEEVPQESWDEGYSTLS    771 - 840
IPPEMLASYQSYSGTFHSLEEQQVCMAVDIGGHRWDQVKKEDQEATGPRLSRELLDEKGPEVLQDSLDRC    841 - 910
YSTPSGYLELTDSCQPYRSAFYILEQQRVGWALDMDEIEKYQEVEEDQDPSCPRLSRELLDEKEPEVLQD    911 - 980
SLDRCYSTPSGYLELPDLGQPYRSAVYSLEEQYLGLALDVDRIKKDQEEEEDQGPPCPRLSRELLEAVEP    981 - 1050
EVLQDSLDRCYSTPSSCLEQPDSCLPYGSSFYALEEKHVGFSLDVGEIEKKGKGKKRRGRRSTKKRRRRG   1051 - 1120
RKEGEEDQNPPCPRLSGMLMEVEEPEVLQDSLDRCYSTPSMYFELPDSFQHYRSVFYSFEEQHISFALDV   1121 - 1190
DNRFLTLMGTSLHLVFQMGVIFPQ                                                 1191 - 1214
//

Text Mined References (10)

PMID Year Title
26802646 2016 Tumor-Suppressor Gene NBPF1 Inhibits Invasion and PI3K/mTOR Signaling in Cervical Cancer Cells.
25958384 2015 NBPF1, a tumor suppressor candidate in neuroblastoma, exerts growth inhibitory effects by inducing a G1 cell cycle arrest.
22973535 2012 Evolutionary history and genome organization of DUF1220 protein domains.
20096688 2010 Chibby interacts with NBPF1 and clusterin, two candidate tumor suppressors linked to neuroblastoma.
16079250 2005 A novel gene family NBPF: intricate structure generated by gene duplications during primate evolution.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11214970 2000 Prediction of the coding sequences of unidentified human genes. XIX. The complete sequences of 100 new cDNA clones from brain which code for large proteins in vitro.
7700633 1995 Constitutional translocation t(1;17)(p36.31-p36.13;q11.2-q12.1) in a neuroblastoma patient. Establishment of somatic cell hybrids and identification of PND/A12M2 on chromosome 1 and NF1/SCYA7 on chromosome 17 as breakpoint flanking single copy markers.