Property Summary

NCBI Gene PubMed Count 14
PubMed Score 76.08
PubTator Score 608.67

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
adult high grade glioma -1.500 5.8e-03
atypical teratoid / rhabdoid tumor -2.000 3.2e-07
ependymoma -1.600 1.3e-07
glioblastoma -1.300 3.7e-02
group 3 medulloblastoma -2.500 5.8e-04
lung adenocarcinoma 1.800 6.3e-06
medulloblastoma, large-cell -2.300 1.7e-04
pancreatic cancer 1.600 1.3e-05
psoriasis -1.200 5.1e-05
spina bifida -1.041 3.7e-02

Gene RIF (5)

AA Sequence

MSFKRPCPLARYNRTSYFYPTFSESSEHSHLLVSPVLVASAVIGVVIILSCITIIVGSIRRDRQARLQRH      1 - 70
RHRHHRHHHHHHHHRRRRHREYEHGYVSDEHTYSRSSRRMRYACSSSEDWPPPLDISSDGDVDATVLREL     71 - 140
YPDSPPGYEECVGPGATQLYVPTDAPPPYSLTDSCPTLDGTSDSGSGHSPGRHQQEQRTPAQGGLHTVSM    141 - 210
DTLPPYEAVCGAGPPSGLLPLPGPDPGPRGSQGSPTPTRAPASGPERIV                         211 - 259
//

Text Mined References (15)

PMID Year Title