Property Summary

NCBI Gene PubMed Count 5
PubMed Score 1.33
PubTator Score 3.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (2)

Expression

  Differential Expression (2)

Disease log2 FC p
osteosarcoma -1.139 0.002
intraductal papillary-mucinous neoplasm ... -1.200 0.013

Synonym

Accession Q32NC0 Q6GW03 Q9BXV6 Q9BXW2
Symbols XTP13
HsT3108
PNAS-124
PNAS-131

Gene

 Compartment GO Term (1)

Gene RIF (1)

PMID Text
22082156 Knockdown of chromosome 18 open reading frame 21 (C18orf21) by siRNA enhances the early stages of HIV-1 replication in HeLa-CD4 cells infected with viral pseudotypes HIV89.6R and HIV8.2N

AA Sequence

MRQKHYLEAAARGLHDSCPGQARYLLWAYTSSHDDKSTFEETCPYCFQLLVLDNSRVRLKPKARLTPKIQ      1 - 70
KLLNREARNYTLSFKEAKMVKKFKDSKSVLLITCKTCNRTVKHHGKSRSFVSTLKSNPATPTSKLSLKTP     71 - 140
ERRTANPNHDMSGSKGKSPASVFRTPTSGQSVSTCSSKNTSKTKKHFSQLKMLLSQNESQKIPKVDFRNF    141 - 210
LSSLKGGLLK                                                                211 - 220
//

Text Mined References (6)

PMID Year Title
24223155 2013 Genome wide analysis of drug-induced torsades de pointes: lack of common variants with large effect sizes.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
16964243 2006 A probability-based approach for high-throughput protein phosphorylation analysis and site localization.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.