Property Summary

NCBI Gene PubMed Count 7
PubMed Score 0.00
PubTator Score 0.56

Knowledge Summary

Patent

No data available

AA Sequence

MNKRTSVDASKEDLHPADPQSGEGVPPNRKNTKTSPRGEGTAPPFSARPCVWTLCEMLSILALVGVLHPF      1 - 70
YRSNNQVYQKLKTHLRCQSSRVDGLMLKPTLLTPSQLKSPEGHLILPTFNHLVIRHILDPKQIFCVADVC     71 - 140
TDCKFNCGSIERHQKRHLMRVSQDWEHLIRYRNQICLS                                    141 - 178
//

Text Mined References (7)

PMID Year Title
24962563 2014 Genome-wide genetic and transcriptomic investigation of variation in antibody response to dietary antigens.
21529783 2011 A quantitative-trait genome-wide association study of alcoholism risk in the community: findings and implications.
20386566 2011 Genome-wide association study of bipolar I disorder in the Han Chinese population.
17903307 2007 Framingham Heart Study genome-wide association: results for pulmonary function measures.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.