Property Summary

NCBI Gene PubMed Count 7
PubMed Score 0.00
PubTator Score 0.56

Knowledge Summary

Patent

No data available

AA Sequence

MNKRTSVDASKEDLHPADPQSGEGVPPNRKNTKTSPRGEGTAPPFSARPCVWTLCEMLSILALVGVLHPF      1 - 70
YRSNNQVYQKLKTHLRCQSSRVDGLMLKPTLLTPSQLKSPEGHLILPTFNHLVIRHILDPKQIFCVADVC     71 - 140
TDCKFNCGSIERHQKRHLMRVSQDWEHLIRYRNQICLS                                    141 - 178
//

Text Mined References (7)

PMID Year Title