Property Summary

NCBI Gene PubMed Count 10
PubMed Score 0.32
PubTator Score 0.25

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
psoriasis 6694 2.9e-56
interstitial cystitis 2312 2.4e-03
Disease Target Count Z-score Confidence
Cryptorchidism 296 3.034 1.5

Expression

  Differential Expression (2)

Disease log2 FC p
interstitial cystitis -3.700 2.4e-03
psoriasis -2.100 2.9e-56

Gene RIF (4)

AA Sequence

MIMSNTHKARLERRVTGSTNRWRLPKQPFSGDLLSLSQMCKALSIDFEEALRNPDRLCISQIQKFFFENF      1 - 70
KNKDIQSGEADVILECLGFKWELHQPQLFQSETLAKLYLKALAQGTTHPLRELEELLRAQSPKKTKEKSP     71 - 140
AKRIIISLKINDPLVTKVAFATALKNLYMSEVEINLEDLLGVLASAHILQFSGLFQRCVDVMIARLKPST    141 - 210
IKKFYEAGCKYKEEQLTTGCEKWLEMNLVPLGGTQIHLHKIPQDLLHKVLKSPRLFTFSEFHLLKTMLLW    211 - 280
VFLQLNYKIQAIPTYETVMTFFKSFPENCCFLDRDIGRSLRPLFLCLRLHGITKGKDLEVLRHLNFFPES    281 - 350
WLDQVTVNHYHALENGGDMVHLKDLNTQAVRFGLLFNQENTTYSKTIALYGFFFKIKGLKHDTTSYSFYM    351 - 420
QRIKHTDLESPSAVYEHNHVSLRAARLVKYEIRAEALVDGKWQEFRTNQIKQKFGLTTSSCKSHTLKIQT    421 - 490
VGIPIYVSFAFIFPAS                                                          491 - 506
//

Text Mined References (10)

PMID Year Title