Property Summary

NCBI Gene PubMed Count 1,767
PubMed Score 1613.47
PubTator Score 6027.77

Knowledge Summary

Patent

No data available

Gene RIF (1722)

AA Sequence

MLVMAPRTVLLLLSAALALTETWAGSHSMRYFHTSVSRPGRGEPRFITVGYVDDTQFVRFDSDAASPREE      1 - 70
PRAPWIEQEGPEYWDRNTQICKAKAQTDRVGLRNLRGYYNQSEDGSHTWQTMYGCDMGPDGRLLRGYNQF     71 - 140
AYDGKDYIALNEDLRSWTAADTAAQITQRKWEAARVAEQLRAYLEGECVEWLRRHLENGKETLQRADPPK    141 - 210
THVTHHPISDHEATLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDGTFQKWAAVVVPSGQEQR    211 - 280
YTCHVQHEGLQEPCTLRWKPSSQSTIPIVGIVAGLAVLVVTVAVVAVVAAVMCRRKSSGGKGGSYSQAAS    281 - 350
SDSAQGSDVSLTA                                                             351 - 363
//

Text Mined References (1770)

PMID Year Title