Property Summary

NCBI Gene PubMed Count 3
PubMed Score 3.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.5
Disease Target Count Z-score Confidence
Mastitis 48 3.662 1.8

Gene RIF (1)

AA Sequence

MKLLTTICRLKLEKMYSKTNTSSTIFEKARHGTEKISTARSEGHHITFSRWKSCTAIGGRCKNQCDDSEF      1 - 70
RISYCARPTTHCCVTECDPTDPNNWIPKDSVGTQEWYPKDSRH                                71 - 113
//

Text Mined References (3)

PMID Year Title