Property Summary

NCBI Gene PubMed Count 3
PubMed Score 2.67

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (1)

Disease Z-score Confidence
Mastitis 48 3.67 1.8

Gene RIF (1)

PMID Text
16033865 The encoded protein is thought to display antimicrobial activity.

AA Sequence

MKLLTTICRLKLEKMYSKTNTSSTIFEKARHGTEKISTARSEGHHITFSRWKSCTAIGGRCKNQCDDSEF      1 - 70
RISYCARPTTHCCVTECDPTDPNNWIPKDSVGTQEWYPKDSRH                                71 - 113
//

Text Mined References (3)

PMID Year Title
25133637 2014 Genome-wide association studies and heritability estimates of body mass index related phenotypes in Bangladeshi adults.
16033865 2005 Cross-species analysis of the mammalian beta-defensin gene family: presence of syntenic gene clusters and preferential expression in the male reproductive tract.
11854508 2002 Discovery of five conserved beta -defensin gene clusters using a computational search strategy.