Property Summary

NCBI Gene PubMed Count 2
PubMed Score 0.00

Knowledge Summary

Patent

No data available

Gene RIF (1)

PMID Text
16033865 The protein encoded by this gene is thought to display antimicrobial activity.

AA Sequence

MNLCLSALLFFLVILLPSGKGMFGNDGVKVRTCTSQKAVCFFGCPPGYRWIAFCHNILSCCKNMTRFQPP      1 - 70
QAKDPWVH                                                                   71 - 78
//

Text Mined References (2)

PMID Year Title
16033865 2005 Cross-species analysis of the mammalian beta-defensin gene family: presence of syntenic gene clusters and preferential expression in the male reproductive tract.
11854508 2002 Discovery of five conserved beta -defensin gene clusters using a computational search strategy.