Property Summary

NCBI Gene PubMed Count 2
PubMed Score 0.00

Knowledge Summary

Patent

No data available

Gene RIF (1)

AA Sequence

MNLCLSALLFFLVILLPSGKGMFGNDGVKVRTCTSQKAVCFFGCPPGYRWIAFCHNILSCCKNMTRFQPP      1 - 70
QAKDPWVH                                                                   71 - 78
//

Text Mined References (2)

PMID Year Title