Property Summary

NCBI Gene PubMed Count 10
PubMed Score 7.77
PubTator Score 8.62

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession Q2YD98 A8K9E6 B2RU11 Q8WTX4 Q9P1Z8
Symbols UVSS3
KIAA1530

Gene

Gene RIF (6)

PMID Text
23760561 UVSSA together with USP7 is implicated in regulating transcription-coupled DNA repair.[review]
23631307 Human UVSSA protein is required for the ubiquitination of RNA polymerase and DNA repair after light-induced DNA damage [review].
22902626 KIAA1530 is an important player in TCR but also lead to a better understanding of the molecular mechanism underlying UV(s)S syndrome.
22466612 Mutations in UVSSA cause UV-sensitive syndrome and destabilize ERCC6 in transcription-coupled DNA repair.
22466611 Mutations in UVSSA cause UV-sensitive syndrome and recruits USP7 to regulate transcription-coupled repair.
22466610 Mutations in the UVSSA gene is associated with UV-sensitive syndrome.

AA Sequence

MDQKLSKLVEELTTSGEPRLNPEKMKELKKICKSSEEQLSRAYRLLIAQLTQEHAEIRLSAFQIVEELFV      1 - 70
RSHQFRMLVVSNFQEFLELTLGTDPAQPLPPPREAAQRLRQATTRAVEGWNEKFGEAYKKLALGYHFLRH     71 - 140
NKKVDFQDTNARSLAERKREEEKQKHLDKIYQERASQAEREMQEMSGEIESCLTEVESCFRLLVPFDFDP    141 - 210
NPETESLGMASGMSDALRSSCAGQVGPCRSGTPDPRDGEQPCCSRDLPASAGHPRAGGGAQPSQTATGDP    211 - 280
SDEDEDSDLEEFVRSHGLGSHKYTLDVELCSEGLKVQENEDNLALIHAARDTLKLIRNKFLPAVCSWIQR    281 - 350
FTRVGTHGGCLKRAIDLKAELELVLRKYKELDIEPEGGERRRTEALGDAEEDEDDEDFVEVPEKEGYEPH    351 - 420
IPDHLRPEYGLEAAPEKDTVVRCLRTRTRMDEEVSDPTSAAAQLRQLRDHLPPPSSASPSRALPEPQEAQ    421 - 490
KLAAERARAPVVPYGVDLHYWGQELPTAGKIVKSDSQHRFWKPSEVEEEVVNADISEMLRSRHITFAGKF    491 - 560
EPVQHWCRAPRPDGRLCERQDRLKCPFHGKIVPRDDEGRPLDPEDRAREQRRQLQKQERPEWQDPELMRD    561 - 630
VEAATGQDLGSSRYSGKGRGKKRRYPSLTNLKAQADTARARIGRKVFAKAAVRRVVAAMNRMDQKKHEKF    631 - 700
SNQFNYALN                                                                 701 - 709
//

Text Mined References (17)

PMID Year Title
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23760561 2013 UVSSA and USP7, a new couple in transcription-coupled DNA repair.
23631307 2013 [Molecular cloning and characterisation of UVSSA, the responsible gene for UV-sensitive syndrome].
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22902626 2012 KIAA1530 protein is recruited by Cockayne syndrome complementation group protein A (CSA) to participate in transcription-coupled repair (TCR).
22466612 2012 Mutations in UVSSA cause UV-sensitive syndrome and destabilize ERCC6 in transcription-coupled DNA repair.
22466611 2012 UV-sensitive syndrome protein UVSSA recruits USP7 to regulate transcription-coupled repair.
22466610 2012 Mutations in UVSSA cause UV-sensitive syndrome and impair RNA polymerase IIo processing in transcription-coupled nucleotide-excision repair.
20834067 2010 Joint influence of small-effect genetic variants on human longevity.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
More...