Property Summary

NCBI Gene PubMed Count 12
PubMed Score 200.55
PubTator Score 13.28

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (4)

Disease Target Count
Alzheimer's disease 644
Disease Target Count P-value
ovarian cancer 8492 2.73259525323676E-8
posterior fossa group A ependymoma 1511 5.89454326805559E-8
group 3 medulloblastoma 2254 3.4360154385201E-6
malignant mesothelioma 3163 7.09446819379665E-6
glioblastoma 5572 1.91407263320632E-4
atypical teratoid / rhabdoid tumor 4369 3.61644637368996E-4
pediatric high grade glioma 2712 3.82686088097457E-4
medulloblastoma, large-cell 6234 4.76379699236947E-4
intraductal papillary-mucinous adenoma (IPMA) 2956 0.0062952014089809
invasive ductal carcinoma 2950 0.00880912200879775
astrocytic glioma 2241 0.010574755926076
ductal carcinoma in situ 1745 0.0461089975400864
subependymal giant cell astrocytoma 2287 0.049945351378786
Disease Target Count Z-score Confidence
Carcinoma 2147 0.0 1.0

Expression

Synonym

Gene

PANTHER Protein Class (2)

  Ortholog (7)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA Inparanoid
Rat OMA Inparanoid
Dog OMA Inparanoid
Pig OMA Inparanoid
Platypus OMA Inparanoid

Gene RIF (1)

PMID Text
18577713 This study confirmed the presence in human cDNA of mouse NDCBE-like transcripts (human NDCBE-A) and three novel transcripts NDCBE-C, NDCBE-D, and NDCBE-D'.

AA Sequence

MPAAGSNEPDGVLSYQRPDEEAVVDQGGTSTILNIHYEKEELEGHRTLYVGVRMPLGRQSHRHHRTHGQK      1 - 70
HRRRGRGKGASQGEEGLEALAHDTPSQRVQFILGTEEDEEHVPHELFTELDEICMKEGEDAEWKETARWL     71 - 140
KFEEDVEDGGERWSKPYVATLSLHSLFELRSCLINGTVLLDMHANSIEEISDLILDQQELSSDLNDSMRV    141 - 210
KVREALLKKHHHQNEKKRNNLIPIVRSFAEVGKKQSDPHLMDKHGQTVSPQSVPTTNLEVKNGVNCEHSP    211 - 280
VDLSKVDLHFMKKIPTGAEASNVLVGEVDILDRPIVAFVRLSPAVLLSGLTEVPIPTRFLFILLGPVGKG    281 - 350
QQYHEIGRSMATIMTDEIFHDVAYKAKERDDLLAGIDEFLDQVTVLPPGEWDPSIRIEPPKNVPSQEKRK    351 - 420
MPGVPNGNVCHIEQEPHGGHSGPELQRTGRLFGGLVLDIKRKAPWYWSDYRDALSLQCLASFLFLYCACM    421 - 490
SPVITFGGLLGEATEGRISAIESLFGASMTGIAYSLFAGQALTILGSTGPVLVFEKILFKFCKDYALSYL    491 - 560
SLRACIGLWTAFLCIVLVATDASSLVCYITRFTEEAFASLICIIFIYEAIEKLIHLAETYPIHMHSQLDH    561 - 630
LSLYYCRCTLPENPNNHTLQYWKDHNIVTAEVHWANLTVSECQEMHGEFMGSACGHHGPYTPDVLFWSCI    631 - 700
LFFTTFILSSTLKTFKTSRYFPTRVRSMVSDFAVFLTIFTMVIIDFLIGVPSPKLQVPSVFKPTRDDRGW    701 - 770
IINPIGPNPWWTVIAAIIPALLCTILIFMDQQITAVIINRKEHKLKKGCGYHLDLLMVAIMLGVCSIMGL    771 - 840
PWFVAATVLSITHVNSLKLESECSAPGEQPKFLGIREQRVTGLMIFVLMGCSVFMTAILKFIPMPVLYGV    841 - 910
FLYMGVSSLQGIQFFDRLKLFGMPAKHQPDFIYLRHVPLRKVHLFTLIQLTCLVLLWVIKASPAAIVFPM    911 - 980
MVLALVFVRKVMDLCFSKRELSWLDDLMPESKKKKLDDAKKKAKEEEEAEKMLEIGGDKFPLESRKLLSS    981 - 1050
PGKNISCRCDPSEINISDEMPKTTVWKALSMNSGNAKEKSLFN                              1051 - 1093
//

Text Mined References (17)

PMID Year Title
23535033 2014 Genome-wide association study of the rate of cognitive decline in Alzheimer's disease.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18577713 2008 Cloning and characterization of novel human SLC4A8 gene products encoding Na+-driven Cl-/HCO3(-) exchanger variants NDCBE-A, -C, and -D.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
17715183 2007 Molecular expression of SLC4-derived Na+-dependent anion transporters in selected human tissues.
16541075 2006 The finished DNA sequence of human chromosome 12.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14736710 2004 Regulation of the human NBC3 Na+/HCO3- cotransporter by carbonic anhydrase II and PKA.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
More...