Property Summary

NCBI Gene PubMed Count 9
PubMed Score 1.58
PubTator Score 2.84

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (2)

Disease log2 FC p
osteosarcoma -5.884 0.000
mucosa-associated lymphoid tissue lympho... 2.450 0.006

Synonym

Accession Q2VPA4 Q32MC9 Q8NEU7
Symbols

Gene

Gene RIF (1)

PMID Text
14687939 CR1L transcript appears to be limited to hematopoietic and fetal lymphoid tissue.

AA Sequence

MAPPVRLERPFPSRRFPGLLLAALVLLLSSFSDQCNVPEWLPFARPTNLTDDFEFPIGTYLNYECRPGYS      1 - 70
GRPFSIICLKNSVWTSAKDKCKRKSCRNPPDPVNGMAHVIKDIQFRSQIKYSCPKGYRLIGSSSATCIIS     71 - 140
GNTVIWDNKTPVCDRIICGLPPTIANGDFTSISREYFHYGSVVTYHCNLGSRGKKVFELVGEPSIYCTSK    141 - 210
DDQVGIWSGPAPQCIIPNKCTPPNVENGILVSDNRSLFSLNEVVEFRCQPGFGMKGPSHVKCQALNKWEP    211 - 280
ELPSCSRVCQPPPDVLHAERTQRDKDNFSPGQEVFYSCEPGYDLRGSTYLHCTPQGDWSPAAPRCEVKSC    281 - 350
DDFLGQLPNGHVLFPLNLQLGAKVDFVCDEGFQLKGSSASYCVLAGMESLWNSSVPVCERKSCETPPVPV    351 - 420
NGMVHVITDIHVGSRINYSCTTGHRLIGHSSAECILSGNTAHWSMKPPICQQIFCPNPPAILNGRHTGTP    421 - 490
LGDIPYGKEVSYTCDPHPDRGMTFNLIGESTIRRTSEPHGNGVWSSPAPRCELPVGAGSHDALIVGKFYE    491 - 560
VFAEEFCHL                                                                 561 - 569
//

Text Mined References (11)

PMID Year Title
25056061 2014 Biological insights from 108 schizophrenia-associated genetic loci.
23382219 2013 Structural basis for endosomal trafficking of diverse transmembrane cargos by PX-FERM proteins.
21700265 2011 Complement receptor 1 gene variants are associated with erythrocyte sedimentation rate.
19060910 2009 Genome-wide association analysis of metabolic traits in a birth cohort from a founder population.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14687939 2004 A human CR1-like transcript containing sequence for a binding protein for iC4 is expressed in hematopoietic and fetal lymphoid tissue.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10737800 2000 Shotgun sequencing of the human transcriptome with ORF expressed sequence tags.
More...