Property Summary

NCBI Gene PubMed Count 14
PubMed Score 4.71
PubTator Score 4.63

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
posterior fossa group B ependymoma 1530 1.70071750552577E-12
juvenile dermatomyositis 1189 2.44184527648339E-11
lung adenocarcinoma 2714 5.15965962407176E-6
cystic fibrosis 1670 5.08429142395066E-5
pancreatic cancer 2300 5.81158905207944E-4
facioscapulohumeral dystrophy 286 6.7589947743272E-4
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.00120907889273846
adult high grade glioma 2148 0.00217002423171722
subependymal giant cell astrocytoma 2287 0.00259647063512195
sarcoidosis 368 0.00359088283968015
primary pancreatic ductal adenocarcinoma 1271 0.00381479583872728
intraductal papillary-mucinous adenoma (IPMA) 2956 0.0043284173745698
oligodendroglioma 2849 0.00576519348972995
colon cancer 1475 0.0113122305499251
active ulcerative colitis 477 0.0196835792988037
intraductal papillary-mucinous carcinoma (IPMC) 2988 0.0206120690166095
gastric carcinoma 832 0.0377878286818413
Disease Target Count Z-score Confidence
Gestational Diabetes 17 3.345 1.7

Expression

Synonym

Gene

  Ortholog (10)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Dog OMA Inparanoid
Horse OMA Inparanoid
Cow OMA Inparanoid
Pig OMA Inparanoid
Opossum OMA Inparanoid
Chicken OMA Inparanoid
Zebrafish OMA Inparanoid

MLP Assay (12)

AID Type Active / Inconclusive / Inactive Description
493160 screening 541 / 0 / 340388 uHTS Fluorescent assay for identification of inhibitors of hexokinase domain containing I (HKDC1)
493187 screening 190 / 0 / 340739 uHTS Fluorescent assay for identification of activators of hexokinase domain containing I (HKDC1)
493190 summary 0 / 0 / 0 Summary assay for small molecule inhibitors of hexokinase domain containing I (HKDC1)
493207 summary 0 / 0 / 0 Summary assay for small molecule activators of hexokinase domain containing I (HKDC1)
504708 screening 104 / 0 / 633 Single concentration confirmation of activators of hexokinase domain containing I (HKDC1)
504710 screening 217 / 0 / 520 Single concentration confirmation of inhibitors of hexokinase domain containing I (HKDC1)
504729 confirmatory 166 / 0 / 49 Dose Response confirmation of inhibitors of hexokinase domain containing I (HKDC1)
504730 confirmatory 44 / 0 / 60 Dose Response confirmation of activators of hexokinase domain containing I (HKDC1)
504763 confirmatory 89 / 0 / 129 Dose Response confirmation of inhibitors of hexokinase domain containing I (HKDC1) in the hexokinase 1 selectivity assay
540304 confirmatory 15 / 0 / 75 SAR analysis of small molecule inhibitors of hexokinase domain containing I (HKDC1)
More...

Gene RIF (6)

PMID Text
23903356 Data identified two novel genome-wide significant associations: 2-h plasma glucose and HKDC1, and fasting C-peptide and BACE2.
22632162 Both HIV-1 Tat 47-59 and FITC-labeled Tat 47-59 peptides downregulate gene expression of hexokinase domain containing 1 (HKDC1) in U-937 macrophages
20800603 Observational study of gene-disease association. (HuGE Navigator)
20732627 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
16385451 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MFAVHLMAFYFSKLKEDQIKKVDRFLYHMRLSDDTLLDIMRRFRAEMEKGLAKDTNPTAAVKMLPTFVRA      1 - 70
IPDGSENGEFLSLDLGGSKFRVLKVQVAEEGKRHVQMESQFYPTPNEIIRGNGTELFEYVADCLADFMKT     71 - 140
KDLKHKKLPLGLTFSFPCRQTKLEEGVLLSWTKKFKARGVQDTDVVSRLTKAMRRHKDMDVDILALVNDT    141 - 210
VGTMMTCAYDDPYCEVGVIIGTGTNACYMEDMSNIDLVEGDEGRMCINTEWGAFGDDGALEDIRTEFDRE    211 - 280
LDLGSLNPGKQLFEKMISGLYLGELVRLILLKMAKAGLLFGGEKSSALHTKGKIETRHVAAMEKYKEGLA    281 - 350
NTREILVDLGLEPSEADCIAVQHVCTIVSFRSANLCAAALAAILTRLRENKKVERLRTTVGMDGTLYKIH    351 - 420
PQYPKRLHKVVRKLVPSCDVRFLLSESGSTKGAAMVTAVASRVQAQRKQIDRVLALFQLTREQLVDVQAK    421 - 490
MRAELEYGLKKKSHGLATVRMLPTYVCGLPDGTEKGKFLALDLGGTNFRVLLVKIRSGRRSVRMYNKIFA    491 - 560
IPLEIMQGTGEELFDHIVQCIADFLDYMGLKGASLPLGFTFSFPCRQMSIDKGTLIGWTKGFKATDCEGE    561 - 630
DVVDMLREAIKRRNEFDLDIVAVVNDTVGTMMTCGYEDPNCEIGLIAGTGSNMCYMEDMRNIEMVEGGEG    631 - 700
KMCINTEWGGFGDNGCIDDIWTRYDTEVDEGSLNPGKQRYEKMTSGMYLGEIVRQILIDLTKQGLLFRGQ    701 - 770
ISERLRTRGIFETKFLSQIESDRLALLQVRRILQQLGLDSTCEDSIVVKEVCGAVSRRAAQLCGAGLAAI    771 - 840
VEKRREDQGLEHLRITVGVDGTLYKLHPHFSRILQETVKELAPRCDVTFMLSEDGSGKGAALITAVAKRL    841 - 910
QQAQKEN                                                                   911 - 917
//

Text Mined References (19)

PMID Year Title
27346736 2016 Hexokinase Domain Containing 1 (HKDC1) Gene Variants and their Association with Gestational Diabetes Mellitus in a South Indian Population.
27155152 2016 High expression of hexokinase domain containing 1 is associated with poor prognosis and aggressive phenotype in hepatocarcinoma.
26803651 2016 Genetics of Gestational Diabetes Mellitus and Maternal Metabolism.
25648650 2015 Coordinated regulatory variation associated with gestational hyperglycaemia regulates expression of the novel hexokinase HKDC1.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24162464 2014 Inferring therapeutic targets from heterogeneous data: HKDC1 is a novel potential therapeutic target for cancer.
23903356 2013 Identification of HKDC1 and BACE2 as genes influencing glycemic traits during pregnancy through genome-wide association studies.
21269460 2011 Initial characterization of the human central proteome.
20800603 2010 Investigation of genetic susceptibility factors for human longevity - a targeted nonsynonymous SNP study.
20732627 2010 Case-control genome-wide association study of attention-deficit/hyperactivity disorder.
More...