Property Summary

NCBI Gene PubMed Count 14
Grant Count 4
R01 Count 1
Funding $394,209
PubMed Score 4.71
PubTator Score 4.63

Knowledge Summary

Patent

No data available

Expression

MLP Assay (12)

AID Type Active / Inconclusive / Inactive Description
493160 screening 541 / 0 / 340388 uHTS Fluorescent assay for identification of inhibitors of hexokinase domain containing I (HKDC1)
493187 screening 190 / 0 / 340739 uHTS Fluorescent assay for identification of activators of hexokinase domain containing I (HKDC1)
493190 summary 0 / 0 / 0 Summary assay for small molecule inhibitors of hexokinase domain containing I (HKDC1)
493207 summary 0 / 0 / 0 Summary assay for small molecule activators of hexokinase domain containing I (HKDC1)
504708 screening 104 / 0 / 633 Single concentration confirmation of activators of hexokinase domain containing I (HKDC1)
504710 screening 217 / 0 / 520 Single concentration confirmation of inhibitors of hexokinase domain containing I (HKDC1)
504729 confirmatory 166 / 0 / 49 Dose Response confirmation of inhibitors of hexokinase domain containing I (HKDC1)
504730 confirmatory 44 / 0 / 60 Dose Response confirmation of activators of hexokinase domain containing I (HKDC1)
504763 confirmatory 89 / 0 / 129 Dose Response confirmation of inhibitors of hexokinase domain containing I (HKDC1) in the hexokinase 1 selectivity assay
540304 confirmatory 15 / 0 / 75 SAR analysis of small molecule inhibitors of hexokinase domain containing I (HKDC1)
More...

Gene RIF (6)

PMID Text
23903356 Data identified two novel genome-wide significant associations: 2-h plasma glucose and HKDC1, and fasting C-peptide and BACE2.
22632162 Both HIV-1 Tat 47-59 and FITC-labeled Tat 47-59 peptides downregulate gene expression of hexokinase domain containing 1 (HKDC1) in U-937 macrophages
20800603 Observational study of gene-disease association. (HuGE Navigator)
20732627 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
16385451 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MFAVHLMAFYFSKLKEDQIKKVDRFLYHMRLSDDTLLDIMRRFRAEMEKGLAKDTNPTAAVKMLPTFVRA      1 - 70
IPDGSENGEFLSLDLGGSKFRVLKVQVAEEGKRHVQMESQFYPTPNEIIRGNGTELFEYVADCLADFMKT     71 - 140
KDLKHKKLPLGLTFSFPCRQTKLEEGVLLSWTKKFKARGVQDTDVVSRLTKAMRRHKDMDVDILALVNDT    141 - 210
VGTMMTCAYDDPYCEVGVIIGTGTNACYMEDMSNIDLVEGDEGRMCINTEWGAFGDDGALEDIRTEFDRE    211 - 280
LDLGSLNPGKQLFEKMISGLYLGELVRLILLKMAKAGLLFGGEKSSALHTKGKIETRHVAAMEKYKEGLA    281 - 350
NTREILVDLGLEPSEADCIAVQHVCTIVSFRSANLCAAALAAILTRLRENKKVERLRTTVGMDGTLYKIH    351 - 420
PQYPKRLHKVVRKLVPSCDVRFLLSESGSTKGAAMVTAVASRVQAQRKQIDRVLALFQLTREQLVDVQAK    421 - 490
MRAELEYGLKKKSHGLATVRMLPTYVCGLPDGTEKGKFLALDLGGTNFRVLLVKIRSGRRSVRMYNKIFA    491 - 560
IPLEIMQGTGEELFDHIVQCIADFLDYMGLKGASLPLGFTFSFPCRQMSIDKGTLIGWTKGFKATDCEGE    561 - 630
DVVDMLREAIKRRNEFDLDIVAVVNDTVGTMMTCGYEDPNCEIGLIAGTGSNMCYMEDMRNIEMVEGGEG    631 - 700
KMCINTEWGGFGDNGCIDDIWTRYDTEVDEGSLNPGKQRYEKMTSGMYLGEIVRQILIDLTKQGLLFRGQ    701 - 770
ISERLRTRGIFETKFLSQIESDRLALLQVRRILQQLGLDSTCEDSIVVKEVCGAVSRRAAQLCGAGLAAI    771 - 840
VEKRREDQGLEHLRITVGVDGTLYKLHPHFSRILQETVKELAPRCDVTFMLSEDGSGKGAALITAVAKRL    841 - 910
QQAQKEN                                                                   911 - 917
//

Text Mined References (19)

PMID Year Title
27346736 2016 Hexokinase Domain Containing 1 (HKDC1) Gene Variants and their Association with Gestational Diabetes Mellitus in a South Indian Population.
27155152 2016 High expression of hexokinase domain containing 1 is associated with poor prognosis and aggressive phenotype in hepatocarcinoma.
26803651 2016 Genetics of Gestational Diabetes Mellitus and Maternal Metabolism.
25648650 2015 Coordinated regulatory variation associated with gestational hyperglycaemia regulates expression of the novel hexokinase HKDC1.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24162464 2014 Inferring therapeutic targets from heterogeneous data: HKDC1 is a novel potential therapeutic target for cancer.
23903356 2013 Identification of HKDC1 and BACE2 as genes influencing glycemic traits during pregnancy through genome-wide association studies.
21269460 2011 Initial characterization of the human central proteome.
20800603 2010 Investigation of genetic susceptibility factors for human longevity - a targeted nonsynonymous SNP study.
20732627 2010 Case-control genome-wide association study of attention-deficit/hyperactivity disorder.
More...