Property Summary

NCBI Gene PubMed Count 3
PubMed Score 1.03
PubTator Score 0.87

Knowledge Summary


No data available


  Disease Sources (2)

Disease Target Count P-value
ovarian cancer 8492 1.04395497589603E-11
Disease Target Count Z-score Confidence
Choroid Plexus Papilloma 10 4.422 2.2
Cornelia de Lange syndrome 21 3.856 1.9


  Differential Expression (1)

Disease log2 FC p
ovarian cancer -1.600 0.000

Gene RIF (1)

23981301 Study describes a novel JNK substrate that emerged from analysis of the human genome, the functionally uncharacterized protein smoothelin-like 2 (SMTNL2). SMTNL2 protein bound with high-affinity to multiple MAPKs including JNK1-3 and ERK2; SMTNL2 protein was expressed in many mammalian tissues, with a notably high expression in skeletal muscle.

AA Sequence

NLANCERLIEVEDMMVMGRKPDPMCVFTYVQSLYNHLRRFE                                 421 - 461

Text Mined References (5)

PMID Year Title
23981301 2013 Combining docking site and phosphosite predictions to find new substrates: identification of smoothelin-like-2 (SMTNL2) as a c-Jun N-terminal kinase (JNK) substrate.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.