Property Summary

NCBI Gene PubMed Count 4
PubMed Score 1.17
PubTator Score 0.87

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
ovarian cancer 8520 1.0e-11
Disease Target Count Z-score Confidence
Choroid Plexus Papilloma 10 4.371 2.2
Cornelia de Lange syndrome 21 3.754 1.9

Expression

  Differential Expression (1)

Disease log2 FC p
ovarian cancer -1.600 1.0e-11

Gene RIF (2)

AA Sequence

MEPAPDAQEARTVREALGRYEAALEGAVRALHEDMRGLQRGVERRVAEAMRLAGPLARTVADLQRDNQRL      1 - 70
QAQLERLTRQVEALGLASGMSPVPGTPGTPSPPPAPGVPDRAPRLGSARFASHATFSLSGRGQSLDHDEA     71 - 140
SESEMRKTSNSCIMENGHQPGAGPGDGPPEIAQNFSAPDPPRPRPVSLSLRLPHQPVTAITRVSDRFSGE    141 - 210
TSAAALSPMSAATLGGLNPSPSEVITPWTPSPSEKNSSFTWSVPSSGYGAVTASKHSNSPPLVTPPQSPV    211 - 280
SPQPPAITQVHRQGERRRELVRSQTLPRTSEAQARKALFEKWEQETAAGKGKGEARARLKRSQSFGVASA    281 - 350
SSIKQILLEWCRSKTLGYQHVDLQNFSSSWSDGMAFCALVHSFFPDAFDYNSLSPTQRQKNFELAFTMAE    351 - 420
NLANCERLIEVEDMMVMGRKPDPMCVFTYVQSLYNHLRRFE                                 421 - 461
//

Text Mined References (6)

PMID Year Title