Property Summary

NCBI Gene PubMed Count 15
Grant Count 5
Funding $460,111.4
PubMed Score 4.70
PubTator Score 124.54

Knowledge Summary

Patent

No data available

Expression

Gene RIF (8)

PMID Text
26617862 MUM-1 could be a useful marker for the differential diagnosis of angioimmunoblastic T cell lymphoma (AITL) with Hodgkin/Reed-Sternberg like cells and classical Hodgkins lymphoma.
26414904 MUM1 expression is reliable in the prognosis of diffuse large B-cell lymphoma.
25149549 These results show that MUM1 is a strong and robust predictive immunohistochemical marker in patients with follicular lymphoma
22158496 Mum-1 was positive in all but one case (96.7%) of systemic anaplastic large-cell lymphoma by tissue microarray immunohistochem analysis.
21903680 The study demonstrated differential MUM-1 expression between PEComas and other true melanocytic tumors
21623692 Data show that BCL-6 (64%) and MUM1 (45%) were expressed in patients with primary mediastinal large B-cell lymphoma.
21569705 expression of CARMA1 mRNA is likely associated with the expression of MUM1 and shows male predominance in diffuse large B cell lymphoma.
20347427 report the identification of the PWWP domain-containing protein EXPAND1/MUM1 as an architectural component of the chromatin, which in response to DNA damage serves as an accessory factor to promote cell survival.

AA Sequence

MADAKYVLCRWEKRLWPAKVLARTATSTKNKRRKEYFLAVQILSLEEKIKVKSTEVEILEKSQIEAIASS      1 - 70
LASQNEVPAAPLEELAYRRSLRVALDVLSEGSIWSQESSAGTGRADRSLRGKPMEHVSSPCDSNSSSLPR     71 - 140
GDVLGSSRPHRRRPCVQQSLSSSFTCEKDPECKVDHKKGLRKSENPRGPLVLPAGGGAQDESGSRIHHKN    141 - 210
WTLASKRGGNSAQKASLCLNGSSLSEDDTERDMGSKGGSWAAPSLPSGVREDDPCANAEGHDPGLPLGSL    211 - 280
TAPPAPEPSACSEPGECPAKKRPRLDGSQRPPAVQLEPMAAGAAPSPGPGPGPRESVTPRSTARLGPPPS    281 - 350
HASADATRCLPCPDSQKLEKECQSSEESMGSNSMRSILEEDEEDEEPPRVLLYHEPRSFEVGMLVWHKHK    351 - 420
KYPFWPAVVKSVRQRDKKASVLYIEGHMNPKMKGFTVSLKSLKHFDCKEKQTLLNQAREDFNQDIGWCVS    421 - 490
LITDYRVRLGCGSFAGSFLEYYAADISYPVRKSIQQDVLGTKLPQLSKGSPEEPVVGCPLGQRQPCRKML    491 - 560
PDRSRAARDRANQKLVEYIVKAKGAESHLRAILKSRKPSRWLQTFLSSSQYVTCVETYLEDEGQLDLVVK    561 - 630
YLQGVYQEVGAKVLQRTNGDRIRFILDVLLPEAIICAISAVDEVDYKTAEEKYIKGPSLSYREKEIFDNQ    631 - 700
LLEERNRRRR                                                                701 - 710
//

Text Mined References (19)

PMID Year Title
26617862 2015 MUM-1 expression differentiates AITL with HRS-like cells from cHL.
26414904 2016 CD10, BCL6, and MUM1 expression in diffuse large B-cell lymphoma on FNA samples.
25416956 2014 A proteome-scale map of the human interactome network.
25149549 2014 Identification of MUM1 as a prognostic immunohistochemical marker in follicular lymphoma using computerized image analysis.
22158496 Immunohistochemical expression of Mum-1, Oct-2 and Bcl-6 in systemic anaplastic large cell lymphomas.
21903680 2012 MUM-1 expression differentiates tumors in the PEComa family from clear cell sarcoma and melanoma.
21720545 2011 Structural and histone binding ability characterizations of human PWWP domains.
21623692 2011 Prognostic impact of MUM1 expression by immunohistochemistry on primary mediastinal large B-cell lymphoma.
21569705 2011 [Correlation between the expressions of CARMA1 gene and MUM1 and its significance in diffuse large B cell lymphoma].
20347427 2010 Regulation of chromatin architecture by the PWWP domain-containing DNA damage-responsive factor EXPAND1/MUM1.
More...