Property Summary

NCBI Gene PubMed Count 8
PubMed Score 4.70
PubTator Score 124.54

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (15)

Disease log2 FC p
astrocytic glioma 1.800 1.1e-02
atypical teratoid / rhabdoid tumor -1.100 2.6e-02
glioblastoma -1.100 1.4e-03
group 4 medulloblastoma -1.100 8.7e-05
interstitial lung disease 1.800 1.7e-05
intraductal papillary-mucinous adenoma (... 1.100 1.1e-02
intraductal papillary-mucinous neoplasm ... 1.400 1.9e-02
medulloblastoma, large-cell -2.000 7.0e-05
oligodendroglioma 1.800 1.4e-02
osteosarcoma -2.230 4.1e-04
ovarian cancer -2.500 2.5e-08
pancreatic ductal adenocarcinoma liver m... 1.279 2.6e-02
posterior fossa group A ependymoma -1.200 1.8e-10
psoriasis -1.800 2.5e-04
tuberculosis 1.200 2.7e-05

Gene RIF (1)

AA Sequence

MADAKYVLCRWEKRLWPAKVLARTATSTKNKRRKEYFLAVQILSLEEKIKVKSTEVEILEKSQIEAIASS      1 - 70
LASQNEVPAAPLEELAYRRSLRVALDVLSEGSIWSQESSAGTGRADRSLRGKPMEHVSSPCDSNSSSLPR     71 - 140
GDVLGSSRPHRRRPCVQQSLSSSFTCEKDPECKVDHKKGLRKSENPRGPLVLPAGGGAQDESGSRIHHKN    141 - 210
WTLASKRGGNSAQKASLCLNGSSLSEDDTERDMGSKGGSWAAPSLPSGVREDDPCANAEGHDPGLPLGSL    211 - 280
TAPPAPEPSACSEPGECPAKKRPRLDGSQRPPAVQLEPMAAGAAPSPGPGPGPRESVTPRSTARLGPPPS    281 - 350
HASADATRCLPCPDSQKLEKECQSSEESMGSNSMRSILEEDEEDEEPPRVLLYHEPRSFEVGMLVWHKHK    351 - 420
KYPFWPAVVKSVRQRDKKASVLYIEGHMNPKMKGFTVSLKSLKHFDCKEKQTLLNQAREDFNQDIGWCVS    421 - 490
LITDYRVRLGCGSFAGSFLEYYAADISYPVRKSIQQDVLGTKLPQLSKGSPEEPVVGCPLGQRQPCRKML    491 - 560
PDRSRAARDRANQKLVEYIVKAKGAESHLRAILKSRKPSRWLQTFLSSSQYVTCVETYLEDEGQLDLVVK    561 - 630
YLQGVYQEVGAKVLQRTNGDRIRFILDVLLPEAIICAISAVDEVDYKTAEEKYIKGPSLSYREKEIFDNQ    631 - 700
LLEERNRRRR                                                                701 - 710
//

Text Mined References (12)

PMID Year Title