Property Summary

NCBI Gene PubMed Count 2
PubMed Score 0.12
PubTator Score 0.11

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
osteosarcoma 7950 9.0e-06
intraductal papillary-mucinous carcinoma (IPMC) 2989 2.5e-02
Disease Target Count Z-score Confidence
Heart conduction disease 83 0.0 1.9

Expression

  Differential Expression (2)

Disease log2 FC p
intraductal papillary-mucinous carcinoma... 1.100 2.5e-02
osteosarcoma 2.085 9.0e-06

AA Sequence

MGEAPSPAPALWDWDYLDRCFARHRVCISFGLWICASSCWIAAHALLLYLRCAQKPRQDQSALCAACCLL      1 - 70
TSLCDTVGALLARQLTIQVFTGAYLAAIDLVNFMFILFPVCGSKFKSNSDREARERKRRRQLRASVFALA     71 - 140
LPLSLGPCWALWVAVPKASATIRGPQRRLLASLLQENTEILGYLLGSVAAFGSWASRIPPLSRIAPPPTL    141 - 210
GITTQHEIWRGQMSKPSQSPSRSPSGHWRAAAQRQVLGTEMCRGKTFPSIHLWTRLLSALAGLLYASAIV    211 - 280
AHDQHPEYLLRATPWFLTSLGRAALDLAIIFLSCVMKSKMRQALGFAKEARESPDTQALLTCAEKEEENQ    281 - 350
ENLDWVPLTTLSHCKSLRTMTAISRYMELTIEPVQQAGCSATRLPGDGQTSAGDASLQDPPSYPPVQVIR    351 - 420
ARVSSGSSSEVSSINSDLEWDPEDVNLEGSKENVELLGSQVHQDSVRTAHLSDDD                   421 - 475
//

Text Mined References (6)

PMID Year Title