Property Summary

NCBI Gene PubMed Count 7
PubMed Score 3.95
PubTator Score 1.81

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (17)

Disease log2 FC p
astrocytic glioma 1.400 2.0e-02
Astrocytoma, Pilocytic 1.100 4.1e-03
atypical teratoid / rhabdoid tumor 1.400 1.7e-03
Breast cancer -1.100 2.3e-10
cutaneous lupus erythematosus -1.100 1.6e-03
cystic fibrosis -1.400 2.1e-04
ependymoma 1.300 2.1e-02
glioblastoma 1.100 3.3e-03
group 3 medulloblastoma 2.000 8.8e-04
malignant mesothelioma 2.200 3.7e-08
oligodendroglioma 1.300 4.9e-03
osteosarcoma -1.161 6.1e-05
ovarian cancer -1.600 1.8e-07
pediatric high grade glioma 1.100 4.1e-03
Pick disease 1.400 2.6e-04
primitive neuroectodermal tumor 1.400 5.8e-03
psoriasis -1.600 1.4e-09

Gene RIF (4)

AA Sequence

MEAGPHPRPGHCCKPGGRLDMNHGFVHHIRRNQIARDDYDKKVKQAAKEKVRRRHTPAPTRPRKPDLQVY      1 - 70
LPRHRDVSAHPRNPDYEESGESSSSGGSELEPSGHQLFCLEYEADSGEVTSVIVYQGDDPGKVSEKVSAH     71 - 140
TPLDPPMREALKLRIQEEIAKRQSQH                                                141 - 166
//

Text Mined References (8)

PMID Year Title