Property Summary

NCBI Gene PubMed Count 7
PubMed Score 3.95
PubTator Score 1.81

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (17)

Disease log2 FC p
malignant mesothelioma 2.300 0.000
astrocytoma 1.500 0.000
ependymoma 1.900 0.010
oligodendroglioma 1.900 0.007
psoriasis -1.600 0.000
cutaneous lupus erythematosus -1.100 0.002
glioblastoma 1.300 0.000
osteosarcoma -2.612 0.000
group 3 medulloblastoma 2.300 0.001
atypical teratoid / rhabdoid tumor 1.400 0.002
primitive neuroectodermal tumor 2.100 0.000
cystic fibrosis -1.400 0.000
pediatric high grade glioma 1.100 0.004
pilocytic astrocytoma 1.100 0.003
inflammatory breast cancer -1.100 0.000
Pick disease 1.400 0.000
ovarian cancer -1.600 0.000

Gene RIF (4)

PMID Text
26607374 hcrcn81 might promote carcinogenesis and progression through regulation of the Wnt/beta-catenin signaling pathway and plays an important role in the carcinogenesis of colorectal cancer.
25023051 c2orf68 expression correlates with the pathogenesis of colorectal cancer through PI3K/Akt/mTOR pathway.
23404111 Observations of the current study indicate that hcrcn81 may play a role in tumorigenesis by regulating the mTOR signaling pathway.
21874238 The mRNA levels of NM_001013649.3 are significantly down-regulated in colorectal adenocarcinoma tissue, and this down-regulation is most likely correlated with the differentiation status of the cancer.

AA Sequence

MEAGPHPRPGHCCKPGGRLDMNHGFVHHIRRNQIARDDYDKKVKQAAKEKVRRRHTPAPTRPRKPDLQVY      1 - 70
LPRHRDVSAHPRNPDYEESGESSSSGGSELEPSGHQLFCLEYEADSGEVTSVIVYQGDDPGKVSEKVSAH     71 - 140
TPLDPPMREALKLRIQEEIAKRQSQH                                                141 - 166
//

Text Mined References (8)

PMID Year Title
26607374 2016 hcrcn81 promotes cell proliferation through Wnt signaling pathway in colorectal cancer.
25023051 2014 The role of c2orf68 and PI3K/Akt/mTOR pathway in human colorectal cancer.
23404111 2013 Hcrcn81 is upregulated by rapamycin treatment in human colorectal adenocarcinoma cells.
21874238 NM_001013649.3 gene is down-regulated in human colorectal adenocarcinoma.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15146197 2004 Transcriptome characterization elucidates signaling networks that control human ES cell growth and differentiation.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.