Property Summary

NCBI Gene PubMed Count 7
PubMed Score 3.95
PubTator Score 1.81

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
astrocytoma 1493 1.96269427763367E-24
psoriasis 6685 1.44381094747837E-9
osteosarcoma 7933 1.70237828047314E-8
malignant mesothelioma 3163 2.58814112265365E-8
ovarian cancer 8492 1.8439989616143E-7
inflammatory breast cancer 404 1.47790110260315E-5
glioblastoma 5572 5.16480329101162E-5
primitive neuroectodermal tumor 3031 1.12990919893526E-4
cystic fibrosis 1670 2.07715906545538E-4
Pick disease 1893 2.55967390222182E-4
group 3 medulloblastoma 2254 0.00119001284715426
cutaneous lupus erythematosus 1056 0.00157195138879933
atypical teratoid / rhabdoid tumor 4369 0.00174369349380289
pilocytic astrocytoma 3086 0.00265978877295961
pediatric high grade glioma 2712 0.0041227855861465
oligodendroglioma 2849 0.00650156155689216
ependymoma 2514 0.00960622977756785
Disease Target Count Z-score Confidence
Colorectal adenocarcinoma 6 4.167 2.1

Expression

  Differential Expression (17)

Disease log2 FC p
malignant mesothelioma 2.300 0.000
astrocytoma 1.500 0.000
ependymoma 1.900 0.010
oligodendroglioma 1.900 0.007
psoriasis -1.600 0.000
cutaneous lupus erythematosus -1.100 0.002
glioblastoma 1.300 0.000
osteosarcoma -2.612 0.000
group 3 medulloblastoma 2.300 0.001
atypical teratoid / rhabdoid tumor 1.400 0.002
primitive neuroectodermal tumor 2.100 0.000
cystic fibrosis -1.400 0.000
pediatric high grade glioma 1.100 0.004
pilocytic astrocytoma 1.100 0.003
inflammatory breast cancer -1.100 0.000
Pick disease 1.400 0.000
ovarian cancer -1.600 0.000

Synonym

Accession Q2NKX9 B4DT10 Q4G0J7 Q6ZVA6
Symbols HCRCN81

Gene

  Ortholog (10)

Species Source
Chimp OMA EggNOG
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG
Horse OMA EggNOG
Cow OMA EggNOG Inparanoid
Opossum EggNOG Inparanoid
Anole lizard OMA EggNOG
Xenopus OMA EggNOG Inparanoid
Zebrafish OMA Inparanoid

Gene RIF (4)

PMID Text
26607374 hcrcn81 might promote carcinogenesis and progression through regulation of the Wnt/beta-catenin signaling pathway and plays an important role in the carcinogenesis of colorectal cancer.
25023051 c2orf68 expression correlates with the pathogenesis of colorectal cancer through PI3K/Akt/mTOR pathway.
23404111 Observations of the current study indicate that hcrcn81 may play a role in tumorigenesis by regulating the mTOR signaling pathway.
21874238 The mRNA levels of NM_001013649.3 are significantly down-regulated in colorectal adenocarcinoma tissue, and this down-regulation is most likely correlated with the differentiation status of the cancer.

AA Sequence

MEAGPHPRPGHCCKPGGRLDMNHGFVHHIRRNQIARDDYDKKVKQAAKEKVRRRHTPAPTRPRKPDLQVY      1 - 70
LPRHRDVSAHPRNPDYEESGESSSSGGSELEPSGHQLFCLEYEADSGEVTSVIVYQGDDPGKVSEKVSAH     71 - 140
TPLDPPMREALKLRIQEEIAKRQSQH                                                141 - 166
//

Text Mined References (8)

PMID Year Title
26607374 2016 hcrcn81 promotes cell proliferation through Wnt signaling pathway in colorectal cancer.
25023051 2014 The role of c2orf68 and PI3K/Akt/mTOR pathway in human colorectal cancer.
23404111 2013 Hcrcn81 is upregulated by rapamycin treatment in human colorectal adenocarcinoma cells.
21874238 NM_001013649.3 gene is down-regulated in human colorectal adenocarcinoma.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15146197 2004 Transcriptome characterization elucidates signaling networks that control human ES cell growth and differentiation.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.