Property Summary

NCBI Gene PubMed Count 11
PubMed Score 1.62
PubTator Score 1.17

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (17)

Disease log2 FC p
adult high grade glioma -2.300 6.9e-07
astrocytic glioma -1.200 8.2e-03
Astrocytoma, Pilocytic -1.600 1.6e-07
atypical teratoid / rhabdoid tumor -1.600 2.5e-08
Breast cancer -1.300 2.9e-05
ependymoma -1.200 2.7e-02
glioblastoma -1.200 5.2e-07
group 3 medulloblastoma -2.000 3.7e-05
interstitial cystitis -1.100 1.6e-03
lung carcinoma 1.500 2.8e-18
medulloblastoma, large-cell -1.300 8.3e-05
oligodendroglioma -1.200 4.8e-08
osteosarcoma -1.025 1.7e-02
ovarian cancer -1.100 1.7e-06
Pick disease -1.700 4.5e-03
primitive neuroectodermal tumor -1.300 4.4e-03
psoriasis -1.400 1.5e-85

Gene RIF (5)

AA Sequence

MASAPAEAETRQRLLRTVKKEVKQIMEEAVTRKFVHEDSSHIISFCAAVEACVLHGLRRRAAGFLRSNKI      1 - 70
AALFMKVGKNFPPAEDLSRKVQDLEQLIESARNQIQGLQENVRKLPKLPNLSPLAIKHLWIRTALFEKVL     71 - 140
DKIVHYLVENSSKYYEKEALLMDPVDGPILASLLVGPCALEYTKMKTADHFWTDPSADELVQRHRIHSSH    141 - 210
VRQDSPTKRPALCIQKRHSSGSMDDRPSLSARDYVESLHQNSRATLLYGKNNVLVQPRDDMEAVPGYLSL    211 - 280
HQTADVMTLKWTPNQLMNGSVGDLDYEKSVYWDYAMTIRLEEIVYLHCHQQVDSGGTVVLVSQDGIQRPP    281 - 350
FRFPKGGHLLQFLSCLENGLLPHGQLDPPLWSQRGKGKVFPKLRKRSPQGSAESTSSDKDDDEATDYVFR    351 - 420
IIYPGMQSEFVAPDFLGSTSSVSVGPAWMMVPAGRSMLVVARGSQWEPARWDTTLPTPSPKEQPPMPQDL    421 - 490
MDVSVSNLPSLWQPSPRKSSCSSCSQSGSADGSSTNGCNHERAPLKLLCDNMKYQILSRAFYGWLAYCRH    491 - 560
LSTVRTHLSALVNHMIVSPDLPCDAGQGLTARIWEQYLHDSTSYEEQELLRLIYYGGIQPEIRKAVWPFL    561 - 630
LGHYQFGMTETERKEVDEQIHACYAQTMAEWLGCEAIVRQRERESHAAALAKCSSGASLDSHLHRMLHRD    631 - 700
STISNESSQSCSSGRQNIRLHSDSSSSTQVFESVDEVEQVEAEGRLEEKQPKIPNGNLVNGTCSPDSGHP    701 - 770
SSHNFSSGLSEHSEPSLSTEDSVLDAQRNTPTVLRPRDGSVDDRQSSEATTSQDEAPREELAVQDSLESD    771 - 840
LLANESMDEFMSITGSLDMALPEKDDVVMEGWRSSETEKHGQADSEDNLSEEPEMESLFPALASLAVTTS    841 - 910
ANEVSPVSSSGVTYSPELLDLYTVNLHRIEKDVQRCDRNYWYFTPANLEKLRNIMCSYIWQHIEIGYVQG    911 - 980
MCDLLAPLLVILDDEALAFSCFTELMKRMNQNFPHGGAMDTHFANMRSLIQILDSELFELMHQNGDYTHF    981 - 1050
YFCYRWFLLDFKRELVYDDVFLVWETIWAAKHVSSAHYVLFIALALVEVYRDIILENNMDFTDIIKFFNE   1051 - 1120
MAERHNTKQVLKLARDLVYKVQTLIENK                                             1121 - 1148
//

Text Mined References (13)

PMID Year Title