Property Summary

NCBI Gene PubMed Count 5
PubMed Score 1.32
PubTator Score 1.20

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
osteosarcoma 7933 1.81101863012266E-8
urothelial carcinoma 318 8.88576019231605E-7
medulloblastoma, large-cell 6234 2.24630175324819E-5
interstitial cystitis 2299 5.17295821308436E-5
medulloblastoma 1524 5.81514589747893E-5
atypical teratoid / rhabdoid tumor 4369 9.0614006211146E-5

Expression

  Differential Expression (6)

Disease log2 FC p
urothelial carcinoma -2.500 0.000
osteosarcoma 1.503 0.000
medulloblastoma -1.200 0.000
atypical teratoid / rhabdoid tumor -1.200 0.000
medulloblastoma, large-cell -1.400 0.000
interstitial cystitis -2.700 0.000

Synonym

Accession Q2M3G4 B7WP40 B7ZL01 Q8TDP0 Q8TF41
Symbols APXL2

Gene

  Ortholog (5)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid

Gene RIF (1)

PMID Text
26484395 FOXP4 and SHROOM1 genes are hypermethylated in the knee osteoarthritic cartilage.

AA Sequence

MEALGPGGDRASPASSTSSLDLWHLSMRADSAYSSFSAASGGPEPRTQSPGTDLLPYLDWDYVRVVWGGP      1 - 70
GPAPPDAALCTSPRPRPAVAARSGPQPTEVPGTPGPLNRQATPLLYALAAEAEAAAQAAEPPSPPASRAA     71 - 140
YRQRLQGAQRRVLRETSFQRKELRMSLPARLRPTVPARPPATHPRSASLSHPGGEGEPARSRAPAPGTAG    141 - 210
RGPLANQQRKWCFSEPGKLDRVGRGGGPARECLGEACSSSGLPGPEPLEFQHPALAKFEDHEVGWLPETQ    211 - 280
PQGSMNLDSGSLKLGDAFRPASRSRSASGEVLGSWGGSGGTIPIVQAVPQGAETPRPLFQTKLSRFLPQK    281 - 350
EAAVMYPAELPQSSPADSEQRVSETCIVPAWLPSLPDEVFLEEAPLVRMRSPPDPHASQGPPASVHASDQ    351 - 420
PYGTGLGQRTGQVTVPTEYPLHECPGTAGADDCWQGVNGSVGISRPTSHTPTGTANDNIPTIDPTGLTTN    421 - 490
PPTAAESDLLKPVPADALGLSGNDTPGPSHNTALARGTGQPGSRPTWPSQCLEELVQELARLDPSLCDPL    491 - 560
ASQPSPEPPLGLLDGLIPLAEVRAAMRPACGEAGEEAASTFEPGSYQFSFTQLLPAPREETRLENPATHP    561 - 630
VLDQPCGQGLPAPNNSIQGKKVELAARLQKMLQDLHTEQERLQGEAQAWARRQAALEAAVRQACAPQELE    631 - 700
RFSRFMADLERVLGLLLLLGSRLARVRRALARAASDSDPDEQASLLQRLRLLQRQEEDAKELKEHVARRE    701 - 770
RAVREVLVRALPVEELRVYCALLAGKAAVLAQQRNLDERIRLLQDQLDAIRDDLGHHAPSPSPARPPGTC    771 - 840
PPVQPPFPLLLT                                                              841 - 852
//

Text Mined References (12)

PMID Year Title
26484395 2016 Identification of differentially methylated regions in new genes associated with knee osteoarthritis.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
16684770 2006 Differential actin-dependent localization modulates the evolutionarily conserved activity of Shroom family proteins.
16615870 2006 A new standard nomenclature for proteins related to Apx and Shroom.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15372022 2004 The DNA sequence and comparative analysis of human chromosome 5.
More...