Property Summary

NCBI Gene PubMed Count 3
PubMed Score 0.25
PubTator Score 0.17

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count Z-score Confidence
Alzheimer's disease 658 0.0 1.0

AA Sequence

MLAPLFLCCLRNLFRKLISFQPPQLGRTNMHYSKLPRTAIETEFKQNVGPPPKDLTAEVYFPSIKSRSHL      1 - 70
PAVFYNQYFKHPKCVGEYGPKNGAERQIEERKVLPTTMMFSMLADCVLKSTPIPILGVAM               71 - 130
//

Text Mined References (4)

PMID Year Title