Property Summary

NCBI Gene PubMed Count 3
PubMed Score 0.25
PubTator Score 0.17

Knowledge Summary

Patent

No data available

AA Sequence

MLAPLFLCCLRNLFRKLISFQPPQLGRTNMHYSKLPRTAIETEFKQNVGPPPKDLTAEVYFPSIKSRSHL      1 - 70
PAVFYNQYFKHPKCVGEYGPKNGAERQIEERKVLPTTMMFSMLADCVLKSTPIPILGVAM               71 - 130
//

Text Mined References (4)

PMID Year Title
22832961 2012 Genome-wide association study of Alzheimer's disease.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.